Curls Poppin Pineapple Collection - So So Clean Vitamin C Leave-In ConditionerOut of stock
Curls

Curls Poppin Pineapple Collection - So So Clean Vitamin C Leave-In Conditioner

BHD 9.60
Out of StockBHBH
Size (1 variants)

8oz

SKU: 868127000477

BHD 9.60

Out of stock

View Now

Description

Formulated with vitamins A, B1, B6 and C, So So Smooth Vitamin C Leave-in Conditioner is the dopest way to refresh, condition and soften your curls every time you style.Additional information Shipping Weight 8 oz Products for Adults Product Type Hair Care Product Use Condition Hair Pattern Wavy, Curly, Very Curly, Kinky Hair Type 2A, 2B, 2C, 3A, 3B, 3C, 4A, 4B, 4C Collections Poppin Pineapple Vitamin C Collection Product Use by Season Winter, Spring, Summer, Fall Product Use by Struggle Dryness, Manageability, Protein Free Product Use by Lifestyle/Occasion On-the-Go/Casual, Travel

Product Information

BrandCurls
CategoryLeave in
MPN / SKU868127000477
Item Group6073624035486
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI