Yoga mat and yoga mat bag set - PSYCHOBELLAOut of stock
Moonholi Yoga

Yoga mat and yoga mat bag set - PSYCHOBELLA

€185.00
Out of StockPLPL
Title (1 variants)

Default Title

SKU: SKU-128-1

€185.00

Out of stock

View Now

Description

Yoga mat set Psychobella Save up 20 EUR when buying a set The Psychobella natural rubber yoga mat is inspired by the spiritual experiences (apparently: P) of people who consume the so-called psychedelic mushrooms. The design of this yoga mat is unisex so everyone loves it. Mushrooms are the dominant graphic element, they are arranged symmetrically, which means that no matter how you unfold the yoga mat , it is great to practice on. We have selected a specific species of mushrooms that those in the know will surely recognize… Mushrooms seem to envelop, hug, engulf - this is a direct reference to the psychedelic experience, which is a repetitive memory motif. The centre of this yoga mat is saturated with symbolism - we have here both the so-called disintegration of the ego, as well as the internal integration of a person, there is also a certain cyclicity and reference to nature. The eye in the centre is associated with the Third Eye, with a broadening of the perspective, sharper vision and understanding, as well as with the observation of oneself and the world. This yoga mat is very psycho, very bella, and very trippy... Includes carrying strap. Yoga Mat Bag MOONWALK Psychobella An ideal and stylish way to carry your yoga mat around. We have designed our Moonwalk yoga mat bags for your ultimate comfort. It is made of strong, durable material to last long and protect all your belongings, with convenient inside pockets to easily locate your water bottle, mobile phone or home keys. It will fit all you need to take with you, including your yoga mat, yoga clothes and personal items, and its truly unique design will make you stand out from the crowd wherever you take it. You can also pair it with a Moonholi Psychobella yoga mat to create a matching look. Ideal to carry your yoga mat to class or beach Fits all yoga essentials Includes handy pockets for water bottle or mobile phone Matches Moonholi yoga mats designs so you can pair it with your Moonholi yoga mat See other yo

Product Information

BrandMoonholi Yoga
CategoryYoga & fitness mat
MPN / SKUSKU-128-1
Item Group7991585636607
CurrencyEUR
CountryPL

Ships to (237 countries)

ACACADADAEAEAFAFAGAGAIAIALALAMAMAOAOARARATATAUAUAWAWAXAXAZAZBABABBBBBDBDBEBEBFBFBGBGBHBHBIBIBJBJBLBLBMBMBNBNBOBOBQBQBRBRBSBSBTBTBWBWBYBYBZBZCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCWCWCXCXCYCYCZCZDEDEDJDJDKDKDMDMDODODZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGDGDGEGEGFGFGGGGGHGHGIGIGLGLGMGMGNGNGPGPGQGQGRGRGSGSGTGTGWGWGYGYHKHKHNHNHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIO
Yoga mat and yoga mat bag set - PSYCHOBELLA — Bobby