Shea Moisture Jamaican Black Castor Oil Hair Mask-29% off
Shea Moisture

Shea Moisture Jamaican Black Castor Oil Hair Mask

BHD 7.20BHD 10.20Save BHD 3.00
In StockBHBH
Title (1 variants)

Default Title

SKU: 764302215554

BHD 7.20

In stock

View Now

Description

Full Product Description Jamaican Black Castor Oil SheaMoisture Masque - Strengthen and Restore Hair Treatment This SheaMoisture Jamaican Black Castor Oil masque is the kind of deep conditioning masque that you want to have around because it quickly restores strength and resilience to damaged, brittle or chemically processed hair. Weak hair easily falls out and when used as a strengthener, it can make a big difference by helping to prevent excessive breakage and shedding. As a restorative treatment, this special blend of hair-friendly oils and protein reinforces healthy follicle growth for better overall hair health. A good choice for those who enjoy hair that is permed, color-treated or regularly styled with heating tools. Formulated with nutrient-rich Jamaican Black Castor Oil, with the addition of certified organic Shea Butter and more. Helps promote natural growth by supporting hair elasticity. This formula also reduces the appearance of breakage and shedding. Peppermint stimulates the scalp for an invigorating experience. Leaves hair soft, manageable and shiny. Product Details SheaMoisture is dedicated to maintaining the accuracy of the ingredient lists on this website. However, because raw ingredients listings are subject to change due to INCI, we cannot guarantee that these lists are complete, up-to-date and/or error-free. For an accurate listing of ingredients in each product, please refer to your product packaging. Usage Instructions After shampooing, apply a generous amount of the strengthening masque from root to ends. Pay particular attention to hair ends. Comb through for even distribution. Place a plastic cap over hair and sit under a warm dryer for 10-15 minutes. May be left on hair for up to 30 minutes without heat. Rinse thoroughly. Style as usual. Ingredients Water, Cetearyl Alcohol, Cocos Nucifera (Coconut) Oil, Glycerin (Vegetable), Butyrospermum Parkii Shea) Butter*‰»«, Stearyl Alcohol, Cetyl Alcohol, Behentrimonium Methosulfate, Fragrance (Esse

Product Information

BrandShea Moisture
CategoryHair Mask
MPN / SKU764302215554
Item Group6102917709982
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI
Shea Moisture Jamaican Black Castor Oil Hair Mask — Bobby