Revitalizing intimate massage drops
COAXcopenhagen.com

Revitalizing intimate massage drops

€23.00
In StockDKDK
Size (1 variants)

30 ml

SKU: BI-0352

€23.00

In stock

View Now

Description

Revitalizing Intimate Massage Drops Self-care just got a lot more intimate. These crystal-clear massage drops are designed to mimic your body’s natural lubrication - without stickiness, fuss, or fillers. Whether you are flying solo with your favorite toy or sharing the moment with a partner, this formula enhances glide, absorbs quickly, and nourishes your most delicate skin. Oh, and your libido? It is in for a treat. Developed in a Barcelona lab with 30+ years of cosmetic expertise, this formula is the gold standard of intimate skincare. Balanced, effective, and powered by SyriCalm™ - a soothing botanical complex that helps restore and protect skin after daily stress or friction. A daily ritual that feels like a little rebellion. The hydration your body has been waiting for More than a massage aid - this is next-level intimate care. With a pH-balanced base and plant-powered actives, these drops are as luxurious as they are functional. Smooth, clean, and so versatile, they slip seamlessly into your pleasure routine or skincare ritual. Hydrate your body. Feed your libido. DETAILS & FEATURES Revitalizing massage drops Designed for intimate use Mimics natural lubrication Absorbs quickly - no sticky residue Enriched with SyriCalm™ pH-balanced and nourishing 30 ml Ingredients: Propanediol, Aqua, Hamamelis Virginiana Leaf Water, Rosa Damascena Flower Water, Aloe Barbadensis Leaf Juice, Citric Acid, Hydroxyethylcellulose, Sodium Benzoate, Glycerin, Potassium Sorbate, Xanthan Gum, Sodium Phytate, Gluconolactone, Sodium Saccharin, Sodium Citrate, Phragmites Karka Extract, Poria Cocos Extract, Panax Ginseng Root Extract, Arnica Montana Flower Extract, Calcium Gluconate.

Product Information

BrandCOAXcopenhagen.com
Categoryaccessories:Massage oil & gel
MPN / SKUBI-0352
Item Group8894212964678
CurrencyEUR
CountryDK

Ships to (235 countries)

ADADAEAEAFAFAGAGAIAIALALAMAMAOAOARARATATAUAUAWAWAXAXAZAZBABABBBBBDBDBEBEBFBFBGBGBHBHBIBIBJBJBLBLBMBMBNBNBOBOBQBQBRBRBSBSBTBTBWBWBYBYBZBZCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCWCWCXCXCYCYCZCZDEDEDJDJDKDKDMDMDODODZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGDGDGEGEGFGFGGGGGHGHGIGIGLGLGMGMGNGNGPGPGQGQGRGRGSGSGTGTGWGWGYGYHKHKHNHNHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQ
Revitalizing intimate massage drops — Bobby