Ombre Purple to White Yoga Pants
GearBunch

Ombre Purple to White Yoga Pants

$93.99
In StockAUAU
Size (5 variants)

XS

Color: Purple

SKU: 7556280

$93.99

In stock

S

Color: Purple

SKU: 6577336

$93.99

In stock

M

Color: Purple

SKU: 8237902

$93.99

In stock

L

Color: Purple

SKU: 3785856

$93.99

In stock

XL

Color: Purple

SKU: 1548075

$93.99

In stock

View Now

Description

These Ombre Purple to White Yoga Pants offer a gradient design that's both calming and energizing. They're perfect for the woman who appreciates subtle sophistication with a touch of personality, whether she's flowing through a yoga sequence or running errands. The soft, flowing colors create a uniquely stylish look that transitions seamlessly from studio to street. Why You'll Love It Super soft, stretchy and comfortable yoga pants. Made from 82% polyester, 18% spandex. Squat-proof fabric ensures confidence during workouts. Four-way stretch allows for a full range of motion. Buttery-soft feel against your skin for all-day comfort. Wide, comfortable waistband stays in place during any activity. Easy care: machine wash cold, tumble dry low. Perfect for yoga, running, or everyday wear. You Might Also Like Ombre Purple to White Leggings Ombre Yellow to White Yoga Pants Ombre Black to White Kid's Leggings From the Blog Best Plus Size Leggings Every Curvy Girl Should Own This Season's Color Trend: Pastels

Product Information

BrandGearBunch
CategoryYoga Pants
MPN / SKU7556280
Item Group1486582808611
CurrencyUSD
CountryAU

Ships to (209 countries)

ADADAEAEAFAFAGAGAIAIALALAMAMAOAOARARATATAUAUAWAWAXAXAZAZBABABBBBBDBDBEBEBFBFBGBGBHBHBLBLBMBMBNBNBQBQBRBRBSBSBTBTBVBVBYBYBZBZCACACCCCCDCDCFCFCHCHCICICKCKCLCLCMCMCOCOCRCRCVCVCWCWCXCXCYCYCZCZDEDEDKDKDMDMDODODZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGDGDGEGEGFGFGGGGGHGHGIGIGLGLGNGNGPGPGQGQGRGRGSGSGTGTGYGYHKHKHMHMHNHNHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOISISITITJEJEJMJMJOJOJPJPKEKEKHKH
Ombre Purple to White Yoga Pants — Bobby