Flora & Curls STYLE ME Sweet Hibiscus Curl Volumizing FoamOut of stock
Flora & Curls

Flora & Curls STYLE ME Sweet Hibiscus Curl Volumizing Foam

BHD 14.40
Out of StockBHBH
Size (1 variants)

300ml

SKU: 5060627510264

BHD 14.40

Out of stock

View Now

Description

Want extra volume? We've got you covered! Our curl-volumizing foam is formulated to add more volume to your favourite hairstyles, naturally. It boasts a silky texture that melts into curls, adding extra body and bounce. This alcohol-free, Vegan and botanical-based formula, instantly lifts curls where it is needed - whether at the roots or across the length of the hair. It is perfect for volumizing your styles - including wash & go’s, roller sets, twist- and braid-outs. Benefits Targets flat, limp areas in the hair with a volumizing moisture boost Helps to create a full-bodied curl pattern Perfect for all curl types A light-weight and alcohol-free formula that won't dry out or weigh down your curls Just a few pumps activate and enhance your natural texture, keeping your curls voluminous throughout the week. Directions Pump it 2-3 times into your palms, then apply to your hair while smoothing it down. Allow curls to form, then air dry to set curls. A hooded dryer, or a diffuser may be used for faster drying. It can be applied to: Dry hair: Apply it lightly to dry 2nd or 3rd-day hair to volumize your curls during the week. Damp or freshly washed hair: Apply it to damp hair then style as usual. For extra curl enhancement, apply it before or after using the Sweet Hibiscus Curl Activating Lotion, Curl Defining Gel and Twist & Braid Cream. A perfect bundle! Ingredients Aqua (Distilled Water), Maltodextrin/VP Copolymer*, Cocamidopropyl Betaine**, Aloe Barbadensis (Aloe Vera) Leaf Juice, Glycerine, Sorbitol, Polysorbate 20, Hydrolyzed Rice Protein, Hydrolyzed Soy Protein, Panthenol Powder, Hibiscus Sabdariffa (Hibiscus) Flower Extract, Althea Officinalis (Marshmallow) Root Extract, Nelumbo Nucifera (Lotus) Flower Extract, Arctium Lappa (Burdock) Root Extract, Prunus Amygdalus Dulcis (Sweet Almond) Oil, Benzyl Alcohol, Sodium Benzoate, Potassium Sorbate, Citric Acid, Tocopherol, Natural Fragrance***, Limonene***, Linalool***, Geraniol***, Citral***, Citronellol*** *naturally

Product Information

BrandFlora & Curls
CategoryStyling Cream
MPN / SKU5060627510264
Item Group7092454654110
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI