Olay Collagen Peptide firming body lotion 502ml
Olay

Olay Collagen Peptide firming body lotion 502ml

BHD 9.60
In StockBHBH
Title (1 variants)

Default Title

SKU: 075609201042

BHD 9.60

In stock

View Now

Description

WHAT IT DOES Radiate confidence with skin that feels as strong as you. Olay Firming Body Lotion with Collagen Peptide, Niacinamide, and Lipids is clinically proven to restore skin barrier. These skincare ingredients help improve skin elasticity and hydration for a youthful appearance, brighten skin tone, and reduce the appearance of fine lines. 91% of users experienced stronger, more resilient skin in just 4 weeks. This powerful body lotion is also formulated with advanced skin-delivery technology, allowing the skin care ingredients to absorb 10 layers deep for visibly improved skin firmness. This weightless body lotion instantly melts into the skin, leaving no greasy residue behind. For optimal results, use the Olay Firming Body Lotion with Olay Serum Body Wash to complete your skincare routine. CLINICALLY PROVEN RESULTS: 91% of users saw stronger, more resilient skin in 4 weeks VISIBLY IMPROVES FIRMNESS: Restores skin's barrier for a more youthful appearance BREAKTHROUGH NEW FORMULA: This body lotion is formulated with skincare ingredients like Collagen Peptide, Niacinamide, & Lipids that absorb 10 layers deep for visibly improved skin WEIGHTLESS MOISTURE: This body lotion instantly melts into skin, leaving no greasy residue behind LUXURIOUS FRAGRANCE: Experience notes of raspberry blended with freesia and warm vanilla FOR BEST RESULTS: Pair Olay's Intensely Hydrating Body Lotion with our serum body wash

Product Information

BrandOlay
CategoryBrand_Olay
MPN / SKU075609201042
Item Group8653411516574
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI
Olay Collagen Peptide firming body lotion 502ml — Bobby