Senjaku Naoshichi Throat LozengesOut of stock
Senjakuamehonpo Co. Ltd.

Senjaku Naoshichi Throat Lozenges

$2.65
Out of StockUSUS
Title (1 variants)

Default Title

SKU: 4901650222780

$2.65

In stock

View Now

Description

Senjaku Naoshichi Throat Lozenges (Seasonal) are conveniently packaged throat lozenges that come is a convenient re-sealable bag. Made using the whole of the legendary citrus fruit "Naoshichi," these throat lozenges allow you to enjoy the flavor of the fruit itself. Naoshi is a type of sudachi. Grown as a gift from nature in Sukumo, Kochi Prefecture, its official name is "Takuma Sudachi" and it is loved locally as a vinegared mandarin orange. Naoshichi is a rare fruit, even in Japan. The small, smooth-skinned fruit comes into season from September to October. It has a bright acidity, similar to lime, and a hint of bitterness. ・Naoshichi flavor ・Made with whole Naokoshichi from Kochi Prefecture ・Contains vitamin C (190mg per product) ・Contains 11 types of Japanese and Chinese herbal extracts Ingredients Nutrition: Sugar (domestically produced), starch syrup, Naoshichi (Takuma Sudachi), herbal extract/acidifier, flavoring, vitamin C, coloring (turmeric). Nutrition: Per 76 grams, Energy: 299kcal, Protein: 0g, Fat: 0.5g, Carbohydrates: 73.7g, Salt equivalent: 0.1g. Manufacturer: Senjakuamehonpo Co., Ltd., 2-5-2 Kawaraya-cho, Chuo-ku, Osaka, Japan, 542-0066 (Head Office). Factory: (Himeji Factory) 841-33 Shirahama-cho Ko, Himeji, Hyogo Prefecture, Japan, 672-8023. Size: Height: 21 cm. Width: 15 cm. Depth: 2.5 cm. Weight: 76 grams. Disclaimer: Japanese Green Tea Shops strives to display the latest product information on our site, but the product specifications ( C apacity, P ackage Design, Ingredients , C ountry of origin, etc.) may change due to the manufacturer's circumstances. For this reason, the product information that is actually delivered may differ from the product information displayed on our site. Please be sure to check the product label and precautionary statement of the delivered product before use. If you need more detailed product information, please contact the manufacturer.

Product Information

BrandSenjakuamehonpo Co. Ltd.
CategoryJapanese Snacks
MPN / SKU4901650222780
Item Group7762861850672
CurrencyUSD
CountryUS

Ships to (235 countries)

ACACADADAEAEAFAFAGAGAIAIALALAMAMAOAOARARATATAUAUAWAWAXAXAZAZBABABBBBBDBDBEBEBFBFBGBGBHBHBIBIBJBJBLBLBMBMBNBNBOBOBQBQBRBRBSBSBTBTBWBWBYBYBZBZCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCWCWCXCXCYCYCZCZDEDEDJDJDKDKDMDMDODODZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGDGDGEGEGFGFGGGGGHGHGIGIGLGLGMGMGNGNGPGPGQGQGRGRGSGSGTGTGWGWGYGYHKHKHNHNHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIO