Shea Moisture Manuka Honey & Yogurt Hydrate + Repair Protein-Strong Treatment-25% off
Shea Moisture

Shea Moisture Manuka Honey & Yogurt Hydrate + Repair Protein-Strong Treatment

BHD 7.20BHD 9.60Save BHD 2.40
In StockBHBH
Size (1 variants)

8oz

SKU: 764302231479

BHD 7.20

In stock

View Now

Description

Full Product Description SheaMoisture Conditioner - Manuka Honey & Mafura Oil Intensive Hydration Conditioner Our highly-rated SheaMoisture Manuka Honey conditioner created for those who need a strong deep conditioner for low porosity natural hair or a deep conditioner for natural hair that is too dry. This rinse-out conditioner infuses your hair strands with nourishing moisture thanks to a powerful blend of certified organic Shea Butter, a creamy, rich base, Manuka Honey, a powerful healing antioxidant and Mafura Oil, a deep-penetrating natural moisturizer. We also include Baobab and Coconut Oils for even more nourishment. The result is a conditioner that instantly softens and detangles while infusing hair with intense moisture and shine-enhancing nutrients. Helps restore manageability and healthy bounce to dry, brittle hair. Antioxidant-rich African Rock Fig helps boost hydration while protecting hair from environmental influences. Leaves hair soft, shiny and easy to style. Product Details SheaMoisture is dedicated to maintaining the accuracy of the ingredient lists on this website. However, because raw ingredients listings are subject to change due to INCI, we cannot guarantee that these lists are complete, up-to-date and/or error-free. For an accurate listing of ingredients in each product, please refer to your product packaging. Usage Instructions Work conditioner through hair from root to ends. Leave on 3 minutes, then rinse. Ingredients Water (Aqua), Stearyl Alcohol, Cetyl Alcohol, Butyropermum Parkii (Shea) Butter *, Cocos Nucifera (Coconut) Oil, Trichliav Emetica Seed Butter, Behentrimonium Chloride, Panthenol, Hydrolyzed Cellulose, Glycerin (Vegetable), Simmondsia Chinensis (Jojoba) Seed Oil, Adansonia Digitata Seed Oil, Dicaprylyl Ether, Honey, Fragrance (Essential Oil Blend) Tocopherol, Aloe Barbadensis Leaf Juice, Hydrolyzed Rice Protein, Caprylhydroxamic Acid, Hydrolyzed Vegetable Protein PG Propyl Silanrtriol, Caprylyl Glycol, Ficus (Fig) Extract Usef

Product Information

BrandShea Moisture
CategoryHair Mask
MPN / SKU764302231479
Item Group6615861690526
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI
Shea Moisture Manuka Honey & Yogurt Hydrate + Repair Protein-Strong Treatment — Bobby