Tgin Quench 3-in-1 Co-Wash Conditioner and Detangler 384ml
Tgin

Tgin Quench 3-in-1 Co-Wash Conditioner and Detangler 384ml

BHD 10.80
In StockBHBH
Title (1 variants)

Default Title

SKU: 858999006219

BHD 10.80

In stock

View Now

Description

DESCRIPTION Kiss dry hair goodbye and say hello to soft, beautiful, moisturized curls with tgin Quench 3-in-1 Co-Wash Conditioner and Detangler. Infused with shea butter, and sweet almond oil, this lightweight formula has the perfect combination of moisture and antioxidants, which helps to improve manageability, fight frizz, and transform dry brittle strands into soft, smooth and healthy hair. Benefits: Leaves strands smooth, soft, and manageable Lightweight formula removes excess product build-up Detangles knots and tangles Reduces frizz and flyaways Prevents split ends and reduces breakage Promotes healthy hair growth Directions Wet hair completely and apply a generous amount of tgin Quench 3-in-1 Co-Wash Conditioner and Detangler to cleanse scalp and remove excess product build up. Rinse well with warm water. Follow with tgin Green Tea Super Moist Leave in Conditioner , or for extra conditioning, tgin Honey Miracle Hair Mask . Ingredients Water (Aqua), Cocos Nucifera (Coconut) Oil, Olea Europaea (Olive) Friut Oil, Malva Sylvestris (Mallow) Flower Extract, Hedera Helix (Ivy) Extract, Parietaria Officinalis (Pellitory) Extract, Cucumis Sativus (Cucumber) Fruit Extract, Sambucus Nigra (Elderberry) Extract, Arnica Montana (Arnica) Flower Extract, Tocopheryl Acetate (Vitamin E), Cetearyl Alcohol, Propanediol, Sodium Coocyl Alaninate, Cetrimonium Chloride, Glyceryl Stearate, Dmdm Hydantoin, Polysorbate 60, Butylene Glycol, Behentrimonium Methosulfate, Stearic Acid, Sodium Coocyl Glutamate, Hydrolyzed Wheat Protein, Caprylyl Glycol, Phenoxyethanol, Fragrance.

Product Information

BrandTgin
CategoryConditioner
MPN / SKU858999006219
Item Group8105269362846
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI