DHIN DHIN Delka With Oud Scrub For Face & Body (Deep Moisturizing Softiness) 250ml
DHIIN DHIIN

DHIN DHIN Delka With Oud Scrub For Face & Body (Deep Moisturizing Softiness) 250ml

BHD 4.80
In StockBHBH
Title (1 variants)

Default Title

SKU: 5280270040226

BHD 4.80

In stock

View Now

Description

DHIN DHIN Delka With Oud Scrub For Face & Body (Deep Moisturizing Softiness) Works to cleanse and tighten the sagging skin, giving the skin a freshness, radiance and tight skin Helps to lighten the skin, unify the color of the body Get rid of the damage of the sun's rays, melasma and blackheads Features a rich source of vitamins, antioxidants and essential fatty acids for enhanced nourishment Ensures to thoroughly and gently clean up impurities without stripping skin of natural oil it is soft, soothing and leaves no greasy residue Ensures to nourish your skin and offers Provides all day hydration to soften, smooth, and plumps skin. Creates a protective moisture barrier for expanding bellies. oil,

Product Information

BrandDHIIN DHIIN
CategoryCream
MPN / SKU5280270040226
Item Group7649635500190
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI
DHIN DHIN Delka With Oud Scrub For Face & Body (Deep Moisturizing Softiness) 250ml — Bobby