As I Am Cocoshea Whip Styling Cream 8oz
As I am

As I Am Cocoshea Whip Styling Cream 8oz

BHD 10.80
In StockBHBH
Title (1 variants)

Default Title

SKU: 858380002189

BHD 10.80

In stock

View Now

Description

Specifically developed for coiled or extremely tight styles, the As I Am CocaShea Whip Styling Cream delivers lightweight hold, superior frizz control and increased manageability. Enriched with moisturising Shea Butter, Coconut Oil and Shikakai Extract, the luxurious cream conditions, hydrates and nourishes, whilst enhancing shine and softening strands from root to tip. Ideal for twists, knots and braids, you can expect smooth, redefined hair without flaking, build-up or greasy residue. Directions: Smooth on as needed to soften and hydrate. Ingredients: Aqua/Water/Eau, Cocos Nucifera (Coconut) Oil, Cetearyl Alcohol, Glycerin, Betaine, Phyllanthus Emblica Fruit Powder, Acacia Concinna Fruit Powder, Dicetyl Phosphate, Ceteth-10 Phosphate, Butyrospermum Parkii (Shea) Butter, Oryza Sativa (Rice) Bran Oil, Polyacrylamide, C13-14 Isoparaffin, Laureth-7, Fragrance/Parfum, Ceteareth-25, Disodium Ethylene Dicocamide PEG-15 Disulfate, Laureth-23, Xanthan Gum, Potassium Sorbate, Caprylyl Glycol, Phenoxyethanol, BHT, Coumarin, Limonene. Ingredients Aqua/Water/Eau, Cocos Nucifera (Coconut) Oil, Butyrospermum Parkii (Shea) Butter, Glycerin, Ceteareth-25, Laureth-23, Potassium Sorbate, TBHQ, Fragrance/Parfum (Anisyl Alcohol, Coumarin, Limonene), Phenoxyethanol, Caprylyl Glycol

Product Information

BrandAs I am
CategoryStyling cream
MPN / SKU858380002189
Item Group8109356974238
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI
As I Am Cocoshea Whip Styling Cream 8oz — Bobby