Black Flocked Shibari Mesh Tube Dress - Bound Language
COAXcopenhagen.com

Black Flocked Shibari Mesh Tube Dress - Bound Language

€79.00
In StockDKDK
Size (7 variants)

XS

SKU: F359.00000

€79.00

In stock

S

SKU: F359.00001

€79.00

In stock

M

SKU: F359.00002

€79.00

In stock

L

SKU: F359.00003

€79.00

In stock

XL

SKU: F359.00004

€79.00

In stock

2XL

SKU: F359.00005

€79.00

In stock

3XL

SKU: F359.00006

€79.00

In stock

View Now

Description

Black Flocked Shibari Mesh Tube Dress This dress doesn’t play - it commands. The sheer mesh wraps around the body in a flocked Shibari-inspired pattern that teases structure, movement, and control. Designed to fit like a whisper and feel like a statement, it is made for nights that do not need introductions. The matte wet look band at the top and bottom creates contrast and precision - smooth against skin, sleek against light. The semi-sheer mesh clings to every line, blurring the boundary between exposure and restraint. Every glance lingers a little longer than it should. Designed to be felt before it’s seen The velvety rope motif moves with your body, creating a rhythm between texture and transparency. Mini in length, magnetic in effect - this dress turns minimal fabric into maximum impact. Slip it on when the mood demands something between art and temptation. DETAILS & FEATURES Black semi-sheer mesh Black flocked Shibari rope pattern Matte wet look trim at top & bottom Mini-length, strapless silhouette Soft stretch fabric with velvet texture Contours & hugs the body Hand-sewn in Europe Please refer to the size guide below, which is adapted to this style.

Product Information

BrandCOAXcopenhagen.com
CategoryBrand: Noir Handmade
MPN / SKUF359.00000
Item Group15176012792134
CurrencyEUR
CountryDK

Ships to (235 countries)

ADADAEAEAFAFAGAGAIAIALALAMAMAOAOARARATATAUAUAWAWAXAXAZAZBABABBBBBDBDBEBEBFBFBGBGBHBHBIBIBJBJBLBLBMBMBNBNBOBOBQBQBRBRBSBSBTBTBWBWBYBYBZBZCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCWCWCXCXCYCYCZCZDEDEDJDJDKDKDMDMDODODZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGDGDGEGEGFGFGGGGGHGHGIGIGLGLGMGMGNGNGPGPGQGQGRGRGSGSGTGTGWGWGYGYHKHKHNHNHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQ