Shea Moisture Manuka Honey & Mafura Oil Intensive Hydration Shampoo 13oz-25% off
Shea Moisture

Shea Moisture Manuka Honey & Mafura Oil Intensive Hydration Shampoo 13oz

BHD 7.20BHD 9.60Save BHD 2.40
In StockBHBH
Title (1 variants)

Default Title

SKU: 764302231042

BHD 7.20

In stock

View Now

Description

Full Product Description Manuka Honey SheaMoisture Shampoo with Mafura Oil Intensive Hydration Formula SheaMoisture Manuka Honey Shampoo with Mafura Oil is truly one of the best Manuka Honey shampoo products designed for all type 4 hair. This sulfate-free shampoo cleanses hair follicles with a luxurious lather that sweetly pampers hair with natural nutrients and moisturizers. By itself, the honey offers powerful antioxidant protection, and we've combined it with rich, exotic Mafura Oil for unparalleled deep masking for curly hair. While infusing hair with intense moisture and shine-enhancing nutrients, our Manuka Honey shampoo is designed to clean well but leave plenty of moisture for after-shampoo manageability. Powerfully effective ingredients include Certified Organic Shea Butter and Baobab, blended into a rich formulation of restorative oils to soften and revitalize hair. Antioxidant-rich African Rock Fig helps boost hydration while protecting distressed hair from environmental influences such as humidity or hot sun rays. Product Details SheaMoisture is dedicated to maintaining the accuracy of the ingredient lists on this website. However, because raw ingredients listings are subject to change due to INCI, we cannot guarantee that these lists are complete, up-to-date and/or error-free. For an accurate listing of ingredients in each product, please refer to your product packaging. Usage Instructions Apply to wet hair, gently massage into a rich lather. Rinse thoroughly. Repeat, if necessary. Ingredients Water (Aqua), Decyl Glucoside, Sodium Lauroyl Lactylate, Glycol Stearate, Glycerin (Vegetable), Hydrolyzed Rice Protein, Panthenol, Butyrospermum Parkii (Shea) Butter*, Fragrance (Essential Oil Blend), Adansonia Digitata Seed Oil, Guar Hydroxypropyltrimonium Chloride, Trichilia Emetica Seed Butter, Ficus Carica (Fig) Extract, Caprylhydroxamic Acid, Caprylyl Glycol, Stearamide AMP, Aloe Barbadensis Leaf Juice, Tocopherol, Honey

Product Information

BrandShea Moisture
CategoryShampoo
MPN / SKU764302231042
Item Group6615861395614
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI