Nice Fresh Body Lotion Papaya 500mlOut of stock
Nice and Fresh

Nice Fresh Body Lotion Papaya 500ml

BHD 6.00
Out of StockBHBH
Title (1 variants)

Default Title

SKU: 8038350014592

BHD 6.00

Out of stock

View Now

Description

Nice Fresh PAPAYA Body lotion is specially added with a variety of moisturizing ingredients especially designed for the body skin care which makes skin texture soft, effectively replenishes skin moisture and nutrients, tightens the skin, makes skin elastic, makes skin instantly smooth & plump and makes your skin young & soft. Papaya extracts in this lotion clears out blemishes and pigmentation. The enzyme, along with alpha-hydroxy acid, works as a powerful exfoliator, dissolving the dead skin cells, reducing the occurrence of clogged pores for a fair and clear glow. Specifications KEY FEATURES Prevent skin aging Lightens Spots, Clears out Blemishes and Pigmentation Glows Lightens Exfoliates Moisturizes. Firms, Makes skin Young, Removes Wrinkles Smooths, Plumps, Replenishes Make skin elastic. WHAT’S IN THE BOX NICE Fresh PAPAYA body lotion SPECIFICATIONS SKU : NI443ST1QLPGLNAFAMZ Production Country : Italy Weight (kg) : 0.5 Main Material : lotion

Product Information

BrandNice and Fresh
CategoryBody Lotion
MPN / SKU8038350014592
Item Group7748902715550
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI
Nice Fresh Body Lotion Papaya 500ml — Bobby