Shea Moisture Jamaican Black Castor Oil Strengthen, Restore Conditioner 13oz-25% off
Shea Moisture

Shea Moisture Jamaican Black Castor Oil Strengthen, Restore Conditioner 13oz

BHD 7.20BHD 9.60Save BHD 2.40
In StockBHBH
Title (1 variants)

Default Title

SKU: 764302017998

BHD 7.20

In stock

View Now

Description

Full Product Description A strengthening conditioner that detangles and restores moisture without weighing hair down. Perfect for those who regularly color, straighten or perm their hair as well as kinky, curly and wavy natural styles. Formulated with Jamaican Black Castor Oil and certified organic Shea Butter to nourish and strengthen damaged, brittle hair, reducing the appearance of breakage and shedding. Peppermint Oil helps stimulate the scalp for an invigorating experience. Leaves hair shiny and fully rejuvenated. Product Details SheaMoisture is dedicated to maintaining the accuracy of the ingredient lists on this website. However, because raw ingredients listings are subject to change due to INCI, we cannot guarantee that these lists are complete, up-to-date and/or error-free. For an accurate listing of ingredients in each product, please refer to your product packaging. Usage Instructions "After shampooing with JAMAICAN BLACK CASTOR OIL STRENGTHEN & RESTORE SHAMPOO, apply generously and comb through for even distribution. Leave in for 3 minutes. Rinse. Style as desired." Ingredients Water, Butyrospermum Parkii (Shea) Butter*‰»«, Cocos Nucifera (Coconut) Oil, Stearyl Alcohol, Cetyl Alcohol, Fragrance (Essential Oil Blend), Behentrimonium Chloride, Hydroxyethylcellulose, Panthenol, Mentha Piperita (Peppermint) Leaf Extract, Glycerin (Vegetable), Simmondsia Chinensis (Jojoba) Seed Oil, Macadamia Ternifolia Seed Oil, Ricinus Communis (Castor) Seed Oil, Hydrolyzed Keratin, Mauritia Flexuosa Fruit Oil, Yeast Extract, Tocopherol, Aloe Barbadensis Leaf Juice, Hydrolyzed Vegetable Protein PG-Propyl Silanetriol, Trifolium Pratense (Clover) Flower Extract, Hydrolyzed Rice Protein, Vinegar, Niacin, Caprylhydroxamic Acid, Caprylyl Glycol, Caramel *Certified Organic Ingredient ?Fair Trade Ingredient

Product Information

BrandShea Moisture
CategoryConditioner
MPN / SKU764302017998
Item Group6102918037662
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI