Nittoh Royal Milk Tea Off TimeOut of stock
Mitsui Norin Co. Ltd.

Nittoh Royal Milk Tea Off Time

$4.19
Out of StockUSUS
Title (1 variants)

Default Title

SKU: 4902831512096

$4.19

In stock

View Now

Description

Nitto Royal Milk Tea Off Time is a package of 8 individually wrapped single serving instant royal milk decaf tea containers using 100% powdered Milk from Hokkaido prefecture and produced in Japan. It is an instant milk tea that is easily dissolved in hot water so you can enjoy the Mellow Taste and Luxurious Aroma at home, work or anywhere. Take a well-deserved pause with Nitto Royal Milk Tea Off Time, a refined instant milk tea crafted for moments of true relaxation. Each box contains 8 individually wrapped sticks, blending the richness of whole milk powder from Hokkaido with the smooth, comforting flavor of Japan’s signature royal milk tea. Specially designed for those who prefer a lighter option, this blend is both decaffeinated (less than 0.001g per serving) and 50% lower in sugar compared to Nitto’s classic Royal Milk Tea—making it a guilt-free indulgence you can enjoy day or night. With its mellow taste and luxurious aroma, simply dissolve a stick in hot water for an instant café-style experience, or prepare it chilled for a refreshing twist. For added richness, replace water with milk and savor a creamier latte-style treat. Perfect for your “off time”—moments of rest, hobbies, or quiet breaks outside of work—this tea embodies the harmony of Japanese tea culture while fitting seamlessly into modern life. Convenient, portable, and always fresh, it’s your ideal companion at home, in the office, or wherever you need a peaceful escape. Instructions: (How to Brew). Just by putting one stick in a cup and pouring hot water, you can easily enjoy an authentic Nittoh Royal Milk Tea Off Time anytime. Hot: Pour one stick in a cup of hot water (120ml), stir well and enjoy. Iced: Pour 1 stick into Cold Water (120ml). Add several pieces of ice and stir well until it becomes cold. (For a Creamy Cafe Latte use Milk or Soy Milk instead of Water). Nutrition: Per cup (9g) Energy: 34kcal, Protein: 0.5g, Fat: 0.7g, Carbohydrate: 7.3g, Salt equivalent: 0.04g, Dietary fiber: 1.8g, Caf

Product Information

BrandMitsui Norin Co. Ltd.
CategoryInstant Tea
MPN / SKU4902831512096
Item Group7752588722224
CurrencyUSD
CountryUS

Ships to (235 countries)

ACACADADAEAEAFAFAGAGAIAIALALAMAMAOAOARARATATAUAUAWAWAXAXAZAZBABABBBBBDBDBEBEBFBFBGBGBHBHBIBIBJBJBLBLBMBMBNBNBOBOBQBQBRBRBSBSBTBTBWBWBYBYBZBZCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCWCWCXCXCYCYCZCZDEDEDJDJDKDKDMDMDODODZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGDGDGEGEGFGFGGGGGHGHGIGIGLGLGMGMGNGNGPGPGQGQGRGRGSGSGTGTGWGWGYGYHKHKHNHNHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIO