Shea Moisture Mango & Carrot Kids Extra-Nourishing Conditioner-25% off
Shea Moisture

Shea Moisture Mango & Carrot Kids Extra-Nourishing Conditioner

BHD 7.20BHD 9.60Save BHD 2.40
In StockBHBH
Title (1 variants)

Default Title

SKU: 764302905011

BHD 7.20

In stock

View Now

Description

Full Product Description SheaMoisture's Mango & Carrot Kids Extra-Nourishing Conditioner softens and smoothes children's hair, making it easy to detangle and work out knots. Helps nourish and strengthen hair while protecting against breakage. Product Details SheaMoisture is dedicated to maintaining the accuracy of the ingredient lists on this website. However, because raw ingredients listings are subject to change due to INCI, we cannot guarantee that these lists are complete, up-to-date and/or error-free. For an accurate listing of ingredients in each product, please refer to your product packaging. Usage Instructions After shampooing, apply a dollop to wet hair. Gently run fingers through hair to distribute evenly. Rinse well with warm water. Ingredients Deionized Water, Decyl Gluoside (Coconut Oil), Olea Europaea (Olive) Fruit Oil*, Cocos Nucifera (Coconut) Oil*, Butyrospermum Parkii (Shea Butter)*, Sorbitol Esters, Mangifera Indica (Mango) Seed Butter*, Vegetable Protein, Glycine Soja (Soybean) Oil, Cetyl Alcohol, Behenetrimonium Chloride, Panthenol (Pro-Vitamin B-5), Citrus Medica Limonium (Lemon), Citrus Aurantifolia (Lime), Citrus Sinensis (Orange Blossom) Extract, Jasminium Officinale, Slippery Elm Extract, Proprietary Essential Oil Blend, Daucus Carota Sativa (Carrot) Seed Oil, Aloe Barbadenis Leaf Extract, Rosemary Extract, Caprylyl Glycol, Tocopherol (Vitamin E) LEGEND *Certified Organic Ingredient.

Product Information

BrandShea Moisture
CategoryKids
MPN / SKU764302905011
Item Group6615861362846
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI
Shea Moisture Mango & Carrot Kids Extra-Nourishing Conditioner — Bobby