Mielle Moisture RX Hawaiian Ginger Moisturizing & Anti-Breakage Conditioner
Mielle

Mielle Moisture RX Hawaiian Ginger Moisturizing & Anti-Breakage Conditioner

BHD 9.60
In StockBHBH
Size (1 variants)

8oz

SKU: 850001265225

BHD 9.60

In stock

View Now

Description

Our Moisture RX Hawaiian Ginger Moisturizing and Anti-Breakage Conditioner is the perfect pair to our Moisturizing and Anti-Breakage Shampoo. Locks in moisture Deeply conditions each strand Brings hair back to life Bring thirsty hair back to life with Mielle Organics’ with this conditioner. This conditioner is made with natural ingredients. It is formulated to deliver both moisture and hydration, ensuring each and every strand is conditioned. Ingredients Water (Aqua, Eau), Cetearyl Alcohol, Isopropyl Palmitate, Cetyl Alcohol, Fragrance (Parfum), Glycerin, Diheptyl Succinate, Capryloyl Glycerin/Sebacic Acid Copolymer, Behentrimonium Chloride, Dipropylene Glycol, Argania Spinosa (Argan) Kernel Oil, Persea Gratissima (Avocado) Oil, Aloe Barbadensis Leaf Juice (Decolorized), Phenoxyethanol, Caprylyl Glycol, Ethylhexylglycerin, Prunus Amygdalus Dulcis (Sweet Almond) Oil, Cocos Nucifera (Coconut) Oil, Brassicyl Isoleucinate Esylate, Brassica Alcohol, Cetyl Esters, Zingiber Officinale (Ginger) Root Oil, Panthenol, Hydrolyzed Oat Protein, Vaccinium Myrtillus Fruit Extract, Saccharum Officinarum (Sugar Cane) Extract, Acer Saccharinum (Sugar Maple) Extract, Citrus Aurantium Dulcis (Orange) Fruit Extract, Citrus Limon (Lemon) Fruit Extract, Rosa Moschata (Rose Hip) Seed Oil, Citric Acid How to use Apply this Moisturizing & Anti-Breakage Conditioner to wet hair after shampooing from root to tip. Leave on 10-15 minutes and rinse thoroughly. Follow up with our Moisture RX Hawaiian Ginger Leave-In Conditioner for added hydration.

Product Information

BrandMielle
CategoryConditioner
MPN / SKU850001265225
Item Group7278422392990
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI