SheaMoisture Jamaican Black Castor Oil Strengthen & Restore Smoothie (12 oz.)Out of stock
Shea Moisture

SheaMoisture Jamaican Black Castor Oil Strengthen & Restore Smoothie (12 oz.)

BHD 10.80
Out of StockBHBH
Size (1 variants)

12oz

SKU: Pcs

BHD 10.80

Out of stock

View Now

Description

Product Details Moisturize and define big, bouncy natural curls, or smooth chemically processed and heat styled hair with this rich, emollient styling smoothie. Nutritive Jamaican Black Castor Oil and certified organic Shea Butter blend in a strengthening formula that restores healthy moisture to damaged, brittle hair while defining curls and reducing frizz. Peppermint Oil invigorates the scalp for a stimulating experience. SheaMoisture Community Commerce is bigger than beauty. It’s about investing in local and global communities, about striving to eliminate generational poverty and empowering women. It’s about overserving the underserved. Usage & Ingredients How to Use: Section damp curly hair and apply generously from roots to ends. Shape curls or smooth through hair. When heat styling, apply sparingly. Do not rinse out. Ingredients: Water, Glycerin (Vegetable), Centrimonium Chloride, Butyrospermum Parkii (Shea) Butter, Glyceryl Stearate Citrate, Cetearyl Alcohol, Cetyl Alcohol, Cocos Nucifera (Coconut Oil), Glyceryl Caprylate, Macadamia Ternifolia Seed Oil, Mangifera Indica (Mango) Seed Butter, Aloe Barbadensis Leaf Juice, Ricinus Communis (Castor) Seed Oil, Vanilla Planifolia Fruit Extract, Mentha Piperita (Peppermint) Leaf Extract, Hydrolyzed Rice Protein, Biotin, Niacinamide, Panthenol, Glyceryl Undecylenate, Fragrance (Essential Oil Blend), Vinergar

Product Information

BrandShea Moisture
CategoryLeave in
MPN / SKUPcs
Item Group7106024734878
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI
SheaMoisture Jamaican Black Castor Oil Strengthen & Restore Smoothie (12 oz.) — Bobby