Halloween Evil Pumpkin Grin Yoga Shorts
GearBunch

Halloween Evil Pumpkin Grin Yoga Shorts

$70.99
In StockAUAU
Size (5 variants)

XS

SKU: 6569701_9079

$70.99

In stock

S

SKU: 6569701_9080

$70.99

In stock

M

SKU: 6569701_9081

$70.99

In stock

L

SKU: 6569701_9082

$70.99

In stock

XL

SKU: 6569701_9083

$70.99

In stock

View Now

Description

Embrace the spooky season with our Halloween Evil Pumpkin Grin Yoga Shorts. This wickedly fun design features a grinning Jack-O'-Lantern motif in black, dark grey, and bright orange, perfect for adding a touch of playful fright to your fitness routine. Ideal for women who love statement prints and want to stand out during their workouts. Why You'll Love It Experience unrestricted movement with these shorts, designed for HIIT, cycling, and outdoor adventures. Enjoy superior comfort thanks to the buttery-soft fabric that feels like a second skin. These squat-proof shorts give you full confidence during any exercise. Stay cool and dry with the breathable, moisture-wicking fabric. Enjoy the freedom of movement thanks to the 4-way stretch material. Provides excellent thigh coverage for confident workouts. Easy care: Machine wash cold, tumble dry low. You Might Also Like Halloween Evil Pumpkin Grin Youth Leggings Halloween Evil Pumpkin Grin Sports bra Halloween Evil Pumpkin Grin Leggings From the Blog A Guide to Frightfully Fun and Healthy Halloween Treats Stylish Halloween Outfits That Are Not Costumes

Product Information

BrandGearBunch
CategoryYoga Shorts
MPN / SKU6569701_9079
Item Group6567115554851
CurrencyUSD
CountryAU

Ships to (209 countries)

ADADAEAEAFAFAGAGAIAIALALAMAMAOAOARARATATAUAUAWAWAXAXAZAZBABABBBBBDBDBEBEBFBFBGBGBHBHBLBLBMBMBNBNBQBQBRBRBSBSBTBTBVBVBYBYBZBZCACACCCCCDCDCFCFCHCHCICICKCKCLCLCMCMCOCOCRCRCVCVCWCWCXCXCYCYCZCZDEDEDKDKDMDMDODODZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGDGDGEGEGFGFGGGGGHGHGIGIGLGLGNGNGPGPGQGQGRGRGSGSGTGTGYGYHKHKHMHMHNHNHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOISISITITJEJEJMJMJOJOJPJPKEKEKHKH
Halloween Evil Pumpkin Grin Yoga Shorts — Bobby