Flora & Curls STYLE ME Sweet Hibiscus Twist & Braid CreamOut of stock-50% off
Flora & Curls

Flora & Curls STYLE ME Sweet Hibiscus Twist & Braid Cream

BHD 6.60BHD 13.20Save BHD 6.60
Out of StockBHBH
Size (1 variants)

300ml

SKU: 5060627510271

BHD 6.60

Out of stock

View Now

Description

Looking for the perfect definition? You've found it. This rich and potent styling cream is a blend of raw tropical Cocoa Butter, Mango Butter and hydrating Aloe Vera Juice . Formulated to intensely moisturize, seal and add superior shine to your style for long-lasting definition. Goodbye to crunchy and dry twist-outs, braid-outs with this thirst-quenching must-have styler. It will keep your tresses nourished all-naturally, and impart a tropical fragrance to your coils. Benefits A rich styling cream formulated to define yours twists and braids, twist-outs, braid-outs, Bantu knots and other styles Works as a great moisturiser for dry hair Boosts curl definition Minimizes frizz for long-lasting definition Deeply moisturises and adds immense shine to the hair Perfect for type 3 and 4 hair types Directions Apply to wet or damp hair. Take a quarter-sized amount into the palm of your hand, then rub palms together to emulsify. Apply before twisting or braiding up small sections of the hair, then allow hair to airdry completely. Gently unravel each section of hair, then style as usual! It can be used after applying the Jasmine Oasis Hydrating Hair Mist. For maximum shine and radiance, unravel hair with the African Citrus Superfruit Hair Oil once the hair is dry. Ingredients Aqua, (Distilled Water), Maltodextrin/VP Copolymer*, Aloe Barbadensis (Aloe Vera) Leaf Juice, Behentrimonium Methosulfate*, Behentrimonium Chloride, Cetearyl Alcohol, Theobroma Cacao (Cocoa) Seed Butter, Ricinus Communis (Castor) Seed Oil, Sodium Benzoate, Potassium Sorbate, Caprylic/Capric Triglyceride, Oryza Sativa (Rice Bran) Oil, Ethyl Macadamiate**, Alkanna Tinctoria (Alkanet) Root Extract, Behentrimonium Chloride, Panthenol Powder, Benzyl Alcohol, Mangifera Indica (Mango) Seed Butter, Hydrolyzed Rice Protein, Hibiscus Sabdariffa (Hibiscus) Flower Extract, Nelumbo Nucifera (Lotus) Flower Extract, Arctium Lappa (Burdock) Root Extract, Prunus Amygdalus Dulcis (Sweet Almond Oil), Tocopherol, Natural Fra

Product Information

BrandFlora & Curls
CategoryStyling Cream
MPN / SKU5060627510271
Item Group7092455833758
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI
Flora & Curls STYLE ME Sweet Hibiscus Twist & Braid Cream — Bobby