Hot Pink Tree of Life Leggings
GearBunch

Hot Pink Tree of Life Leggings

$88.99
In StockAUAU
Size (5 variants)

XS

Color: Hot Pink

SKU: 7716164

$88.99

In stock

S

Color: Hot Pink

SKU: 3825791

$88.99

In stock

M

Color: Hot Pink

SKU: 3181171

$88.99

In stock

L

Color: Hot Pink

SKU: 2674528

$88.99

In stock

XL

Color: Hot Pink

SKU: 7529261

$88.99

In stock

View Now

Description

Embrace your vibrant side with our Hot Pink Tree of Life Leggings. This design features a striking, nature-inspired tree motif against a bold pink backdrop, perfect for the woman who loves to make a statement and connect with the beauty of the natural world. Wear these full-length leggings for yoga, running, or simply adding a pop of color to your everyday look. Why You'll Love It Eye-catching hot pink Tree of Life print that wraps around the leg, creating a visually stunning effect. Full-length coverage provides a streamlined silhouette, offering both style and comfort. Buttery-soft fabric that feels like a second skin, moving with you effortlessly. Wide, comfortable waistband that stays in place during workouts, preventing any slipping or rolling. Squat-proof and non-see-through fabric ensures confidence during any activity. Four-way stretch material allows for a full range of motion, ideal for yoga, gym sessions, or running. Easy care: machine wash cold, tumble dry low for lasting vibrancy. You Might Also Like Rave Sound Wave Bike Shorts Blue Wave Flare Leggings Apricot Wave Capris From the Blog Vegetarian Diets and Quality of Life 8 Keys to Living Longer and Better Life

Product Information

BrandGearBunch
CategoryLeggings
MPN / SKU7716164
Item Group209947262995
CurrencyUSD
CountryAU

Ships to (209 countries)

ADADAEAEAFAFAGAGAIAIALALAMAMAOAOARARATATAUAUAWAWAXAXAZAZBABABBBBBDBDBEBEBFBFBGBGBHBHBLBLBMBMBNBNBQBQBRBRBSBSBTBTBVBVBYBYBZBZCACACCCCCDCDCFCFCHCHCICICKCKCLCLCMCMCOCOCRCRCVCVCWCWCXCXCYCYCZCZDEDEDKDKDMDMDODODZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGDGDGEGEGFGFGGGGGHGHGIGIGLGLGNGNGPGPGQGQGRGRGSGSGTGTGYGYHKHKHMHMHNHNHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOISISITITJEJEJMJMJOJOJPJPKEKEKHKH