Shea Moisture Manuka Honey and Yogurt Hydrate+Repair Shampoo, Conditioner And Masque-29% off
Shea Moisture

Shea Moisture Manuka Honey and Yogurt Hydrate+Repair Shampoo, Conditioner And Masque

BHD 20.40BHD 28.80Save BHD 8.40
In StockBHBH
Title (1 variants)

Default Title

SKU: Set

BHD 20.40

In stock

View Now

Description

Brand SheaMoisture Material Type Free Mineral Oil Free, Sulfate Free, Phthalate Free, Petroleum Free, Paraben Free Hair Type Brittle, Dry, Normal About this item CLEANSES & STRENGTHENS - Shea Moisture Manuka Honey and Yogurt Hydrate+Repair Shampoo is a moisturizing shampoo for damaged hair that works alone to gently cleanse hair and strengthen strands from root to tip when used with our conditioner. RESTORES & REPAIRS - Restore and repair with this moisture Shampoo by Shea Moisture that replenishes moisture to dry, brittle strands, while promoting a healthy shine. SOFTENS & DETANGLES - Shea Moisture Manuka Honey and Yogurt Hydrate & Repair Conditioner is a deep conditioner and rinse-out conditioner that softens, detangles and infuses damaged hair with intensive moisture for hair repair. RESTORES HAIR VITALITY - This deep hair conditioner smooths rough, dry cuticles and seals for split end repair; use this damaged hair treatment to restore vitality to dull, lackluster hair for healthy hair that lasts. REINFORCES & REVITALIZES - With its blend of all-natural ingredients, including organic Shea Butter, Shea Moisture's Manuka Honey & Yogurt Hydrate + Repair Protein-Strong Treatment Masque gives your hair new life by providing dry hair benefits from reparative proteins that naturally reinforce and revitalize over-processed, abused hair fibers.

Product Information

BrandShea Moisture
CategoryCombo
MPN / SKUSet
Item Group6735675687070
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI