Tsuboichi Masala Chai LatteOut of stock
Tsuboichi Tea Corporation

Tsuboichi Masala Chai Latte

$4.49
Out of StockUSUS
Title (1 variants)

Default Title

SKU: 4967262014649

$4.49

In stock

View Now

Description

Tsuboichi Masala Chai Latte is a package containing 80 grams of high quality Masala Chai Latte in an instant powder (Dairy Free). Simply mix in milk to create a rich and delicious Masala Chai latte. Tsuboichi Masala Chai Latte — Authentic Spice, Japanese Craftsmanship Indulge in a comforting cup of Masala Chai crafted with remarkable care. This 80-gram instant latte powder blends Assam black tea with five aromatic spices, each one thoughtfully selected by Tsuboichi’s expert tea appraisers to evoke the warmth and depth of an authentic chai experience. Simply whisk into your favorite milk—whether dairy, soy, almond, oat, or another plant-based option—and enjoy a rich, velvety chai latte that’s entirely dairy-free and free from additives, flavorings, colorings, or artificial sweeteners. Founded in 1850 in Sakai, Osaka, the historic home of Sen no Rikyu, Tsuboichi continues to honor centuries-old tea-making traditions while seeking the finest ingredients from across Japan. Every blend reflects the brand’s commitment to purity, craftsmanship, and a lifestyle enriched by genuinely delicious tea. A cup of quiet luxury—warm, spiced, and effortlessly soothing, inviting you to slow down and savor the simple pleasure of true Japanese tea artistry. Instructions: ( How to Brew). Just add hot milk, and you can easily enjoy an Authentic Masala Chai Latte. Hot: Add two table spoons of powder (about 10grams) to 100-120ml hot milk, microwave (500W) for about one minute, stir well. Iced: Add two table spoons of powder (about 10 grams) to 100-120ml hot milk, stir well and add 2 to 3 ice cubes. Nutrition: Per 1 serving (8 Grams) Energy: 28.4Kcal, Protein: 0.4g, Fat: 0.07g, Carbohydrate: 6.9g, Salt equivalent: 0.003g. Ingredients : Cane sugar (Okinawa Prefecture, Japan), black tea, cinnamon, cloves, dried ginger, nutmeg, cardamom. Manufacturer: Tsuboichi Tea Corporation, 1-14-18 Takashihama, Takaishi City, Osaka Prefecture, Japan, 592-0004 . Size: Height: 14.5 cm. Width: 14 cm. Depth: 4

Product Information

BrandTsuboichi Tea Corporation
CategoryInstant Tea
MPN / SKU4967262014649
Item Group7783452409904
CurrencyUSD
CountryUS

Ships to (235 countries)

ACACADADAEAEAFAFAGAGAIAIALALAMAMAOAOARARATATAUAUAWAWAXAXAZAZBABABBBBBDBDBEBEBFBFBGBGBHBHBIBIBJBJBLBLBMBMBNBNBOBOBQBQBRBRBSBSBTBTBWBWBYBYBZBZCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCWCWCXCXCYCYCZCZDEDEDJDJDKDKDMDMDODODZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGDGDGEGEGFGFGGGGGHGHGIGIGLGLGMGMGNGNGPGPGQGQGRGRGSGSGTGTGWGWGYGYHKHKHNHNHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIO
Tsuboichi Masala Chai Latte — Bobby