As I Am Cleansing Pudding - Sulfate-Free Moisturizing Cleanser- 8oz
As I am

As I Am Cleansing Pudding - Sulfate-Free Moisturizing Cleanser- 8oz

BHD 9.60
In StockBHBH
Title (1 variants)

Default Title

SKU: 858380002158

BHD 9.60

In stock

View Now

Description

A rich sulfate-free creamy moisturizing beauty bath for your hair! Contains a special blend of natural ingredients, including saw palmetto and phytosterols, that helps to eliminate DHT build-up from the scalp, and promote healthy hair growth from the follicular level. Cleanses hair of residue and product build-up Moisturizes as it cleanses Rids scalp of excess sebum, environmental impurities and shedding scalp debris Provides a soothing scalp treatment Helps promote a healthy environment for hair growth Ingredients Aqua/Water/Eau, Cetearyl Alcohol, Sodium Cocoamphopropionate, Hydroxypropyl Starch Phosphate, Behentrimonium Chloride, Citrus Reticulata (Tangerine) Fruit Extract, Aloe Barbadensis Leaf Extract, Sodium Benzoate, Potassium Sorbate, Erythorbic Acid, Citric Acid, Glycerin, Phytosterols, Serenoa Serrulata Fruit Extract, Ricinus Communis (Castor) Seed Oil, Curcuma Longa (Turmeric) Root Powder, Piroctone Olamine, Cetrimonium Chloride, Phenoxyethanol, Caprylyl Glycol, Fragrance/Parfum (Limonene), Potassium Sorbate Usage Wet hair thoroughly. Rub a liberal amount within palms and distribute throughout hair. Lather product through hair and massage into scalp. Carefully detangle hair with a wide-tooth comb. Leave on 3-5 minutes in order to eliminate shedding scalp debris. Rinse well. Repeat only if necessary to remove excessive product build up.

Product Information

BrandAs I am
CategoryShampoo
MPN / SKU858380002158
Item Group8103113719966
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI