Vitale Olive Oil Hair Mayonnaise 4lbs
Vitale

Vitale Olive Oil Hair Mayonnaise 4lbs

BHD 9.60
In StockBHBH
Title (1 variants)

Default Title

SKU: 743690080906

BHD 9.60

In stock

View Now

Description

VITALE Olive Oil Hair Mayonnaise 4 lb with Oat & Egg Protein and Vitamins - Good on Color & Thermal Treated Hair - for Dry & Damaged Scalp Men, Women & Kids -Moisturize and Condition VITALE OILVE OIL Hair Mayonnaise with Oat Protein, Cholesterol and Natural Botanical extracts to intensively condition, moisturize and strengthen dry or damaged. ALL NATURAL EXTRACTS with our organic proteins moisturize and condition all hair types directly enriching the root & scalp while renewing weak fragile hair. DAILY USE encourages damage repair on all hair conditions even color or thermal treated hair. ADDING THIS ALL NATURAL hair cream will work as a shield to protect your hair from any harmful thermal presence while Repairing Chemically damaged hair. Having this Olive Oil Hair Mayonnaise in your hair care regiment will benefit you extremely especially if hair needs strengthening.

Product Information

BrandVitale
CategoryHair Treatment
MPN / SKU743690080906
Item Group8109099090078
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI