Shea Moisture coconut & Hibiscus Curl enhancing smoothie-28% off
Shea Moisture

Shea Moisture coconut & Hibiscus Curl enhancing smoothie

BHD 7.80BHD 10.80Save BHD 3.00
In StockBHBH
Size (1 variants)

12oz

SKU: 764302290223

BHD 7.80

In stock

View Now

Description

Full Product Description Coconut Hibiscus Curl Enhancing Smoothie for Defining Curls - Hydration and Shine SheaMoisture's Coconut & Hibiscus Curl Enhancing Smoothie is enriched with natural ingredients to give you soft, silky and defined curls! Enriched with certified organic Shea Butter, this conditioning enhancing smoothie blends the tropical richness of Coconut Juice and Oil with other choice oils for a truly unique hydrating experience. In fact, this SheaMoisture curly hair formula is so rich, all you need is a little dab to instantly smooth those unruly split ends. It also works wonders for taming stray flyaway hair strands that are common when hair is too dry, damaged and over-processed. Make it a go-to daily moisturizing treatment for favorite styles or for a hair transition from permed to natural. It smells divine and makes your hair gloriously shiny, with noticeable bouncy curls! SheaMoisture's Coconut & Hibiscus Curl Enhancing Smoothie is an all-natural leave on styling cream specially formulated for wavy, curly hair. Coconut oil used in this moisturizing formula hydrates and protects hair against breakage while replenishing lost oils. Neem Oil imparts brilliant shine and adds volume and definition to dull, lifeless curls and coils. This enhancing smoothie bottles in the benefits of Silk Protein, an important ingredient that softens unruly locks, making them irresistibly smooth and easy to manage. Product Details SheaMoisture is dedicated to maintaining the accuracy of the ingredient lists on this website. However, because raw ingredients listings are subject to change due to INCI, we cannot guarantee that these lists are complete, up-to-date and/or error-free. For an accurate listing of ingredients in each product, please refer to your product packaging. Usage Instructions Section hair and apply product sparingly to damp or dry hair. Do not rinse out. Style hair as desired. For best results, use as a styling cream for twist-outs, braids and wash-and-go st

Product Information

BrandShea Moisture
CategoryStyling Cream
MPN / SKU764302290223
Item Group6102917349534
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI
Shea Moisture coconut & Hibiscus Curl enhancing smoothie — Bobby