As I am curl clarity shampoo 8ozOut of stock
As I am

As I am curl clarity shampoo 8oz

BHD 9.60
Out of StockBHBH
Title (1 variants)

Default Title

SKU: 858380002004

BHD 9.60

Out of stock

View Now

Description

As I Am - Classic - Curl Clarity Shampoo Remove the Dull. Bring On the Shine! Ease of Combing improved by 62%. Detangling of Curls made easier by 78%. At times your coils or curls just won't act right and it's difficult to make them shine and behave. These are the tell-tell signs that it's time to remove the old, dulling residue and make a fresh clean start, but without dehydrating your hair. Benefits Gently removes product build up and environmental impurities from the hair and scalp. Sulfate-free. Will not strip hair of the precious natural moisture that makes it thrive. Leaves behind moisture, preventing hair from becoming dried out, rough-looking and unmanageable. Safe for color-treated hair. After use, your hair will be ready to receive again all of the good things you give it for style and maintenance Ingredients Aqua/Water/Eau, Sodium Lauroyl Sarcosinate, Cocamidopropyl Betaine, Hydroxypropyl Methylcellulose, Cocos Nucifera (Coconut) Fruit Powder, Phyllanthus Emblica Fruit Powder, Citrus Reticulata (Tangerine) Fruit Extract, Fragrance/Parfum, Citric Acid, Phenoxyethanol, Caprylyl Glycol, Sodium Benzoate, Limonene. Usage Wet hair thoroughly. Gently massage into lather throughout hair and scalp. Rinse well. Repeat as necessary. Follow with conditioning. Use either As I Am¨ Hydration Elation¨ Intensive Conditioning Treatment or As I Am¨ Leave-In Conditioner. Use as needed on an intermittent basis with the other As I Am¨ cleansers: Cleansing Pudding+ Sulfate-Free Moisturizing Cleanser for the Hair & Scalp and Coconut CoWash Cleansing Conditioner. Immediately after clarifying is the perfect time to experience intense conditioning with As I Am¨ Hydration Elation¨ Intensive Conditioner. Tips of Joy Make sure to detangle completely during either the shampoo step or the conditioning step, while the hair is soaking wet and saturated with the lather or conditioner. Use a wide toothed comb or, if you prefer, a paddle brush. Only after detangling should you proceed to the

Product Information

BrandAs I am
CategoryShampoo
MPN / SKU858380002004
Item Group6064364454046
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI