Shea Moisture Jamaican Black Castor Oil Strengthen & Restore Shampoo 487ml-25% off
Shea Moisture

Shea Moisture Jamaican Black Castor Oil Strengthen & Restore Shampoo 487ml

BHD 7.20BHD 9.60Save BHD 2.40
In StockBHBH
Size (1 variants)

16oz

SKU: 764302314394

BHD 7.20

In stock

View Now

Description

Full Product Description This Sulfate-free, clarifying shampoo removes buildup, while infusing hair with nourishing moisture. Perfect for those who regularly color, straighten, perm or heat style their hair, as well as kinky, curly or wavy natural styles. Formulated with Jamaican Black Castor Oil and certified organic Shea Butter to help promote natural growth by strengthening damaged or chemically processed hair, reducing breakage and the resultant shedding. Peppermint Oil helps invigorate the scalp for a tingling experience. Product Details SheaMoisture is dedicated to maintaining the accuracy of the ingredient lists on this website. However, because raw ingredients listings are subject to change due to INCI, we cannot guarantee that these lists are complete, up-to-date and/or error-free. For an accurate listing of ingredients in each product, please refer to your product packaging. Usage Instructions Apply to wet hair, gently massage from root to ends. Rinse thoroughly. Repeat if necessary. For best results pair with JAMAICAN BLACK CASTOR OIL STRENGTHEN & RESTORE CONDITIONER. Ingredients Water (Aqua), Decyl Glucoside, Sodium Lauroyl Lactylate, Fragrance (Essential Oil Blend), Glycerin (Vegetable), Hydrolyzed Rice Protein, Panthenol, Hydrolyzed Vegetable Protein PG-Propyl Silanetriol, Guar Hydroxypropyltrimonium Chloride, Butyrospermum Parkii (Shea) Butter*‰»«, Ricinus Communis (Castor) Seed Oil, Mentha Piperita (Peppermint) Leaf Extract, Mauritia Flexuosa Fruit Oil, Hydrolyzed Keratin, Tocopherol, Aloe Barbadensis Leaf Juice, Vinegar, Yeast Extract, Niacin, Trifolium Pratense (Clover) Flower Extract, Caprylhydroxamic Acid, Caprylyl Glycol, Caramel *Certified Organic Ingredient. ‰»«Fair Trade Ingredient.

Product Information

BrandShea Moisture
CategoryShampoo
MPN / SKU764302314394
Item Group7105998192798
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI
Shea Moisture Jamaican Black Castor Oil Strengthen & Restore Shampoo 487ml — Bobby