Cantu Color Protecting Conditioner
Cantu

Cantu Color Protecting Conditioner

BHD 7.80
In StockBHBH
Size (1 variants)

13oz

SKU: 817513016837

BHD 7.80

In stock

View Now

Description

Color Protecting Conditioner Cantu Color Protecting Conditioner conditions hair and scalp without stripping color. Keeps your red, blond, brown, or black hues vibrant longer! Limit fade with our unique silicone-free formula specially made with Quinoa Protein Color Protecting Technology designed to lock in color and limit fade due to rinse-off. No mineral oil, sulfates, parabens, silicones, phthalates, gluten, paraffin or propylene. Benefits: Moisturizes to enhance color vibrancy Protects color while improving manageability For color treated hair Formulated with Quinoa ProTech™ Technology: up to 84% less red color fade when Cantu Color Protecting Shampoo and Conditioner are used as a system. HOW TO USE Apply a generous amount to damp hair starting at the ends and work towards the roots. Rinse with cool

Product Information

BrandCantu
CategoryConditioner
MPN / SKU817513016837
Item Group6059690164382
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI