Shea Moisture Moringa & Avocado Power Greens Reconstructor mentOut of stock
Shea Moisture

Shea Moisture Moringa & Avocado Power Greens Reconstructor ment

BHD 10.20
Out of StockBHBH
Size (1 variants)

8oz

SKU: Pcs

BHD 10.20

Out of stock

View Now

Description

Full Product Description Strengthen weak strands and minimize breakage. Designed to infuse hair fibers with intense moisture to help strengthen weak and brittle strands, smoothening rough cuticles for a frizz free styling. Product Details SheaMoisture is dedicated to maintaining the accuracy of the ingredient lists on this website. However, because raw ingredients listings are subject to change due to INCI, we cannot guarantee that these lists are complete, up-to-date and/or error-free. For an accurate listing of ingredients in each product, please refer to your product packaging. Usage Instructions Section clean, wet hair. Apply generously. Use a wide tooth comb to distribute evenly from root to ends. Leave in for 5 minutes. Rinse thoroughly. Ingredients Water, Glycerin (Vegetable), Cetearyl Alcohol, Stearyl Alcohol, Cetyl Alcohol, Butyrospermum Parkii (Shea) Butter*♥, Isopropyl Myristate, Olea Europaea (Olive) Fruit Oil, Moringa Oleifera Seed Oil, Persea Gratissima (Avocado) Oil, Camellia Sinensis (Green Tea) Leaf Powder, Prunus Amygdalus Dulcis (Sweet Almond) Oil, Brassica Oleracea Acephala (Kale) Leaf Extract, Melia Azadirachta (Neem) Leaf Extract, Melia Azadirachta (Neem) Flower Extract, Chlorella Vulgaris Extract, Hydrolyzed Soy Protein, Hydrolyzed Rice Protein, Sodium Lauroyl Hydrolyzed Silk, Citrus Medica Limonum (Lemon) Juice, Tocopherol, Behentrimonium Chloride, Cetrimonium Chloride, Capryloyl Glycerin/Sebacic Acid Copolymer, Diheptyl Succinate, Glycine Soja (Soybean) Oil, Triethyl Citrate, Caprylyl Glycol, Benzoic Acid, Fragrance (Essential Oil Blend) *Certified Organic Ingredient ♥Fair Trade Ingredient

Product Information

BrandShea Moisture
CategoryHair Mask
MPN / SKUPcs
Item Group7116155093150
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI
Shea Moisture Moringa & Avocado Power Greens Reconstructor ment — Bobby