As I am Rich Daily Moisturizer - Double Butter Cream
As I am

As I am Rich Daily Moisturizer - Double Butter Cream

BHD 16.80
In StockBHBH
Size (2 variants)

8oz

SKU: 858380002097

BHD 14.40

In stock

16oz

SKU: 858380002103

BHD 16.80

Out of stock

View Now

Description

Rich Daily Moisturizer - Double Butter Cream Lavish Your Coils and Curls. Give Your Hair What It's Asking For... the Moisture Needed to Feel and Look Amazing! Moisture is essential for great natural coils and curls. When your hair feels a bit rough and dry, and looks that way too, this is the jar to reach for. The power-packed As I Am ® DoubleButter ® Cream is a rich emollient blend, graced with the finest array of natural butters and organic oils. It gets the job done. Benefits Locks in moisture Gives dull dry hair softness, shine and manageability Contains Pro-vitamin B5, (known as Panthenol), to help repair split ends and strengthen hair Provides dehydrated hair with what it needs to look and behave its very best Ingredients Aqua/Water/Eau, Butyrospermum Parkii (Shea) Butter, Hydrogenated Vegetable Oil, Theobroma Cacao (Cocoa) Seed Butter, Prunus Amygdalus Dulcis (Sweet Almond) Oil, Cetearyl Alcohol, Ethoxylated Sorbitan Ester, Cocos Nucifera (Coconut) Oil, Glycerin, Ricinus Communis (Castor) Seed Oil, Cera Alba/Beeswax/Cire d'abeille, Lanolin, Betaine, Beta Vulgaris (Beet) Root Extract, Cocos Nucifera (Coconut) Fruit Powder, Phyllanthus Emblica Fruit Powder, Citrus Reticulata (Tangerine) Fruit Extract, Simmondsia Chinensis (Jojoba) Seed Oil, Hydrolyzed Wheat Protein, Potassium Sorbate, Phenoxyethanol, Tocopheryl Acetate, Triethanolamine, Potassium Sorbate, Phenoxyethanol, Caprylyl Glycol, Fragrance/Parfum (Anise Alcohol, Coumarin, Limonene), Curcuma Longa (Turmeric) Root Powder Usage Apply sparingly or liberally depending upon your hair's need for moisture, manageability and vitality. Rub within palms and scrunch onto hair gently so that coils and curls are undisturbed. May also be used to set soft lustrous twists and twist-outs. Tips Try using a little As I Am ® DoubleButter ® Cream along with the Twist Defining Cream for in-between re-twist touch-ups. Don't rub oils and butters into your finished style too vigorously. It can disturb coil/curl definition. Inste

Product Information

BrandAs I am
CategoryStyling Cream
MPN / SKU858380002103
Item Group6064364650654
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI