Shea Moisture Coconut Hibiscus Curl & Shine Shampoo-25% off
Shea Moisture

Shea Moisture Coconut Hibiscus Curl & Shine Shampoo

BHD 7.20BHD 9.60Save BHD 2.40
In StockBHBH
Size (1 variants)

13oz

SKU: 764302290209

BHD 7.20

In stock

View Now

Description

Full Product Description SheaMoisture Shampoo Coconut and Hibiscus Curl and Shine Hair Repair Treatment Managing messy curls is not as hard as you think! Get shiny, bouncy, and unbelievably manageable hair with SheaMoisture Coconut & Hibiscus Curl & Shine Shampoo. If you're looking for a shampoo without sulfate in the ingredients list, this sulfate-free hair care product creates a rich lather that smells great as it cleanses your hair and scalp of impurities. Our formulation combines hand-picked natural ingredients and certified organic Shea Butter to create a gentle cleanser that improves hair health and restores its lustrous shine. After one wash, you may join the chorus of happy customers who praise this Coconut & Hibiscus product as the best shampoo and conditioner for curly hair. SheaMoisture Coconut & Hibiscus Curl & Shine Shampoo is loaded with everything you need to tame your wavy, curly or kinky, coily hair. Working with thick hair that is all too often dry or split ends that make hair strands weaker? The coconut oil blended in this gently hydrating formulation moisturizes and protects hair while replenishing lost oil. Rosemary and Aloe Oils give hair even more hydration and Hibiscus flower extracts improve hair elasticity, reducing the occurrence of breakages and split ends. Silk protein makes hair silky and soft while Neem Oil helps in repairing hair and gives your curls a brilliant shine! The rich, creamy lather of SheaMoisture's Coconut & Hibiscus Curl & Shine Shampoo gently washes away impurities leaving you with naturally fragrant, frizz free, healthy waves and curls! Product Details SheaMoisture is dedicated to maintaining the accuracy of the ingredient lists on this website. However, because raw ingredients listings are subject to change due to INCI, we cannot guarantee that these lists are complete, up-to-date and/or error-free. For an accurate listing of ingredients in each product, please refer to your product packaging. Usage Instructions Apply

Product Information

BrandShea Moisture
CategoryShampoo
MPN / SKU764302290209
Item Group6102917578910
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI
Shea Moisture Coconut Hibiscus Curl & Shine Shampoo — Bobby