Weekend Base (Hema Free)
KoKo & Claire

Weekend Base (Hema Free)

$15.95
In StockCACA
Title (1 variants)

Default Title

SKU: 102

$15.95

In stock

View Now

Description

Base (Weekend Base)

Weekend Base

Koko & Claire "Base" ensures a healthy nail and easy removal of your gel polish mani.  Cure for 45 seconds in our signature Koko & Claire LED lamp.  

Now includes "Residue Remover"!

 Peel-Off Base instructions

 **Requires a UV/LED Light**

 

Peel-Off Base Instructions

 

To Remove:  Simply buff the surface of your "Shine" (the systems Top Coat) and soak in hot water for 7-10 minutes.   Lifting the corner of your polish gently, simply peel off your mani, hydrate your nail and pick a new color to design your next look!

Product Information

BrandKoKo & Claire
Category"Essential" Foundations
MPN / SKU102
Item Group2054953828450
CurrencyUSD
CountryCA

Ships to (130 countries)

AEAEAGAGAIAIAOAOARARATATAUAUAWAWBEBEBGBGBMBMBNBNBOBOBRBRBSBSBWBWBYBYBZBZCACACHCHCICICLCLCNCNCOCOCRCRCVCVCWCWCYCYCZCZDEDEDKDKDMDMDODOECECEEEEEGEGERERESESETETFIFIFJFJFRFRGBGBGDGDGFGFGHGHGIGIGPGPGQGQGRGRGTGTGYGYHKHKHNHNHRHRHTHTHUHUIDIDIEIEILILIMIMININIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKRKRKZKZLBLBLKLKLRLRLTLTLVLVMQMQMSMSMTMTMUMUMWMWMXMXMYMYMZMZNANANCNCNGNGNININLNLNONONZNZOMOMPAPAPEPEPHPHPKPKPLPLPTPT
Weekend Base (Hema Free) — Bobby