Clere Triple Glycerine Enriched Rich Musk Body Cream 500 mlOut of stock
Clere

Clere Triple Glycerine Enriched Rich Musk Body Cream 500 ml

BHD 4.80
Out of StockBHBH
Title (1 variants)

Default Title

SKU: 6001374081064

BHD 4.80

Out of stock

View Now

Description

Clere Triple Glycerine Enriched Rich Musk Body Cream 500 ml: Clere Triple Glycerine Enriched Rich Musk Body Cream is a luxurious and nourishing body cream that is enriched with triple glycerine to provide intense hydration and moisturization to the skin. The rich musk fragrance leaves your skin smelling fresh and clean all day long. This body cream is perfect for those with dry or sensitive skin, as it helps to soothe and calm irritated skin while providing long-lasting moisture. It absorbs quickly into the skin without leaving any greasy residue, leaving your skin feeling soft, smooth, and supple. The triple glycerine formula helps to lock in moisture by forming a protective barrier on the surface of the skin. This barrier helps to prevent moisture loss throughout the day, keeping your skin hydrated for longer periods of time. Overall, Clere Triple Glycerine Enriched Rich Musk Body Cream is an excellent choice for anyone looking for a high-quality body cream that provides intense hydration and nourishment while leaving their skin smelling fresh and clean.

Product Information

BrandClere
CategoryCream
MPN / SKU6001374081064
Item Group7538339610782
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI
Clere Triple Glycerine Enriched Rich Musk Body Cream 500 ml — Bobby