Eden BW Coconut Shea Leave In Conditioner-38% off
Eden

Eden BW Coconut Shea Leave In Conditioner

BHD 4.80BHD 7.80Save BHD 3.00
In StockBHBH
Title (1 variants)

Default Title

SKU: 765591005505

BHD 4.80

In stock

View Now

Description

Coconut Shea Leave In Conditioner A daily conditioning treatment that adds hydration and seals in moisture. Together, its main ingredients — Coconut Oil and Shea Butter — work hand-in-hand to penetrate the hair shaft while also protecting against protein loss and increasing shine. Nutrient-rich and lightweight, this Leave In has a creamy consistency that allows for easy application and distribution. It serves as an excellent style primer, especially when used as a base for a defined wash 'n go!

Product Information

BrandEden
CategoryLeave in
MPN / SKU765591005505
Item Group7279631073438
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI