Shea Moisture Manuka Honey Masque with Mafura Oil - Deep Conditioner for Hair 13oz-29% off
Shea Moisture

Shea Moisture Manuka Honey Masque with Mafura Oil - Deep Conditioner for Hair 13oz

BHD 7.20BHD 10.20Save BHD 3.00
In StockBHBH
Title (1 variants)

Default Title

SKU: 764302231066

BHD 7.20

In stock

View Now

Description

Full Product Description SheaMoisture Manuka Honey Masque with Mafura Oil - Deep Conditioner for Hair Manuka honey is a special type of honey that is relished for its natural healing properties for hair and skin. Due to its excellent versatility, this honey blends well with a wide range of conditioning oils, and Mafura oil is one of our favorite combinations. This SheaMoisture Manuka Honey Masque provides intense conditioning for hair that is thirsty for moisture, especially curly hair. This deep conditioner infuses hair with a powerful dose of moisture and nutrients. Depending on the condition of your hair, it can be a quick hydration boost or an extra deep conditioning treatment. Ideal for revitalizing over-processed hair, damaged hair or color-treated hair. Certified organic Shea Butter, Honey, Mafura and Baobab Oils are blended with antioxidant-rich African Rock Fig to restore and lock in moisture. Smooths and fortifies follicles for stronger, healthier frizz-free hair. Product Details SheaMoisture is dedicated to maintaining the accuracy of the ingredient lists on this website. However, because raw ingredients listings are subject to change due to INCI, we cannot guarantee that these lists are complete, up-to-date and/or error-free. For an accurate listing of ingredients in each product, please refer to your product packaging. Usage Instructions Section clean, wet hair. Apply generously. Use a wide tooth comb to distribute evenly from root to ends. Leave in for 5 minutes. Rinse thoroughly. For extra conditioning , cover hair with a plastic cap. Apply moderate heat for up to 30 minutes. When using a steamer do not cover hair. Moist heat will add to masque's hydration. Ingredients Water (Aqua), Cetyl Alcohol, Cocos Nucifera (Coconut) Oil, Behentrimonium Methosulfate, Butyrospermum Parkii (Shea) Butter*, Glycerin (Vegetable), Stearyl Alcohol, Behentrimonium Chloride, Panthenol, Trichilia Emetica (Mafura) Seed Oil, Honey, Hydrolyzed Rice Protein, Fragrance (Essenti

Product Information

BrandShea Moisture
CategoryHair Mask
MPN / SKU764302231066
Item Group6710821027998
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI