PKC Ultimate Protein Keratin With Collagen straightening Professional Home care Kit
PKC

PKC Ultimate Protein Keratin With Collagen straightening Professional Home care Kit

BHD 26.40
In StockBHBH
Title (1 variants)

Default Title

SKU: 7898617374071

BHD 26.40

In stock

View Now

Description

PKC Ultimate Protein straightening set, includes: Step1: Protein Keratin With Collagen Shampoo 140 ml Step2: Protein Keratin With Collagen Thermal Sealant blow dry 140 ml Step3: Protein Keratin With Collagen True Brazilian Keratin 140 ml The PKC Ultimate micro-particles penetrate the hair fibers' cortex, acting as a complex replenisher, providing hair with strength, softness, and radiance. Within minutes PKC is naturally absorbed by the hair fiber. After sealing the fibers with iron particles, the PKC particles fuse with the cortex proteins, shielding the strands and fully closing the cuticles. Through this process, PKC provides hair with extraordinary and natural smoothness. Benefits: Perfect straightening of hair strands Extreme volume reduction Natural smoothness Anti-frizz from Brazil

Product Information

BrandPKC
CategoryHair Treatment
MPN / SKU7898617374071
Item Group8415081103518
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI
PKC Ultimate Protein Keratin With Collagen straightening Professional Home care Kit — Bobby