Flora & Curls STYLE ME Sweet Hibiscus Curl Activating LotionOut of stock
Flora & Curls

Flora & Curls STYLE ME Sweet Hibiscus Curl Activating Lotion

BHD 12.00
Out of StockBHBH
Size (1 variants)

300ml

SKU: 5060627510165

BHD 12.00

Out of stock

View Now

Description

A botanically packed curl activator styling cream formulated to activate your curl shape, and reveal your pattern without any crunch. It is a frizz-combating formula, and glides smoothly, nourishing enough to add body and shine. Perfect for your wash & go's, twist outs and braid outs, this curl essential delivers instant curl enhancement, leaving coily and curly styles smooth and bouncy with immense shine and soft hold. “Amazing! This product is a must on wash day! I also use it regularly to refresh my curls - it makes such a difference and my curls have really taken shape!'' — Customer Review Directions Section hair, and apply curl activator to damp hair to encourage softer, defined curls or apply to hair during the week for a curl pick-me up. Use together with the Sweet Hibiscus Curl Defining Gel for extra definition. Ingredients Aqua (Distilled Water), Behentrimonium Methosulfate*, Hydroxypropyltrimonium (Honey), Cocos Nucifera (Coconut) Oil, Cetearyl Alcohol, Butyrospermum Parkii (Shea Butter), Olea Europaea (Olive) Fruit Oil, Cetyl Alcohol, Hydrolyzed Soy Protein, Hibiscus Sabdariffa (Hibiscus) Flower Extract, Nelumbo Nucifera (Lotus) Flower Extract, Ricinus communis (Castor) Seed Oil, Butylene Glycol, Hydroxyethylcellulose*, Arctium Lappa (Burdock) Root Extract, Rosmarinus Officinalis (Rosemary) Leaf Extract, Hydrolyzed Wheat Protein, Calendula Officinalis (Calendula) Extract, Benzyl Alcohol, Panthenol (Pro-Vitamin B5), Potassium Sorbate, Sodium Benzoate, (Tocopherol) Vitamin E, Citric Acid, Citronellol**, Geraniol**, Limonene**, Linalool**, Citral, Natural Aroma*** *derived from coconut or natural gum **natural component of essential oils ***100% natural essential oils

Product Information

BrandFlora & Curls
CategoryStyling Cream
MPN / SKU5060627510165
Item Group7092453507230
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI