Cantu Color Protecting Moisture Masque
Cantu

Cantu Color Protecting Moisture Masque

BHD 7.80
In StockBHBH
Size (1 variants)

12oz

SKU: 817513016851

BHD 7.80

In stock

View Now

Description

Color Protecting Moisture Masque Cantu Color Protecting Moisture Masque’s moisture rich formula penetrates deep into the hair shaft for an intense treatment to repair, restore and strengthen color treated hair. Plus the Quinoa Protein Color Protecting Technology improves color retention while shea butter and baobab seed oil deeply moisturize and increase color vibrancy and shine. No mineral oil, sulfates, parabens, silicones, phthalates, gluten, paraffin or propylene. Benefits: Strengthens & softens color treated hair HOW TO USE Apply generously immediately after shampooing to clean, damp hair from ends to roots. Cover hair with plastic cap—for deeper penetration, apply moderate heat for 15 minutes. Rinse thoroughly with cool water. For fragile, transitioning or over-processed hair, apply generously to hair then cover with plastic cap and silk scarf overnight. In the morning, rinse hair with cool water. Style as usual.

Product Information

BrandCantu
CategoryHair Mask
MPN / SKU817513016851
Item Group6059708383390
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI