Vitale Olive Oil Anti-breakage Foam Wrap Lotion-237ml 8oz
Vitale

Vitale Olive Oil Anti-breakage Foam Wrap Lotion-237ml 8oz

BHD 4.80
In StockBHBH
Title (1 variants)

Default Title

SKU: 743690043468

BHD 4.80

In stock

View Now

Description

VITALE Olive Oil Foam Wrap Hair Lotion, 8 fl oz - Flake-Free Anti-Breakage Styling - for Men & Women - Safe for Color Treated Scalp - Moisturize for All Hair Types Vitale Olive Oil Foam Wrap Lotion is a unique herbal blend that prevents breakage and provides moisture with long lasting hold. Its light formula is perfect for wraps, roller sets, wet looks and molds for short tapered looks. Excellent for blow drying and protects hair from heat. Foam Wrap Lotion Benefits Moisturizes and protects hair from heat Lightweight formula dries fast with no flaking Long-lasting hold Directions After shampooing and conditioning your hair with Vitale Olive Oil hair products , towel dry and disperse Vitale Olive Oil Anti-Breakage Foam Wrap lotion into palms and massage into hair from root to ends. Style and dry. Ingredients Water (Aqua), Cocamidopropyl Betaine, Polysorbate 20, PVP, PEG-75 Lanolin, Polyquaternium-10, Tocopheryl Acetate (Vitamin E), Panthenol (Vitamin B5), Propylene Glycol, Sodium Chloride, Sodium Benzoate, Olea Europaea (Olive) Husk Oil, Hydrolyzed Vegetable Protein, Benzyl Benzoate, Potassium Sorbate, Phenoxyethanol, Ethylhexylglycerin, Linalool, Fragrance (Parfum).

Product Information

BrandVitale
CategoryMousse
MPN / SKU743690043468
Item Group8109100630174
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI