As I Am Naturally Coil Defining Jelly 16oz/454 gr
As I am

As I Am Naturally Coil Defining Jelly 16oz/454 gr

BHD 16.80
In StockBHBH
Title (1 variants)

Default Title

SKU: 858380002226

BHD 16.80

In stock

View Now

Description

Coil Defining Jelly 16oz is formulated without flakes, specially designed for easy spiral definition by providing softness, hydration and shine. This styling jelly is easy to use and formulated without flakes. Ideal for Wash n' Go style. Containing Aloe Vera, Alma powder and Shikakai extract to stimulate growth. Opt for natural: -To bring definition and shine to the hair -To maintain the afro or Wash n'Go style -For softer hair and easy to style -Without leaving unsightly white residue -To soften, deeply moisturize, regenerate and strengthen hair Directions for use: Start with detangled, clean hair starting from the root to the ends. Do not dry hair with the towel. Ingredients : Aqua/Water/Water, Glycerin, Glyceryl Acrylate/Acrylic Acid Copolymer, Aloe Barbadensis Leaf Juice, Pectin, Betaine, Phyllanthus Emblica Fruit Powder, Acacia Concinna Fruit Powder, Tocopheryl Acetate, Fragrance/Parfum, Linum Usitatissimum (Linseed) Seed Extract, Carbomer, PPG-5-Ceteth-20, Aminomethyl Propanol, Polyquaternium-11, Caprylyl Glycol, Phenoxyethanol, Potassium Sorbate, Coumarin, Limonene.

Product Information

BrandAs I am
CategoryStyling Gel
MPN / SKU858380002226
Item Group8103190790302
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI