Shea Moisture Raw Shea Butter deep treatment Masque 12oz-29% off
Shea Moisture

Shea Moisture Raw Shea Butter deep treatment Masque 12oz

BHD 7.20BHD 10.20Save BHD 3.00
In StockBHBH
Title (1 variants)

Default Title

SKU: 764302280248

BHD 7.20

In stock

View Now

Description

Full Product Description SheaMoisture Raw Shea Butter Deep Treatment Masque - SheaMoisture Hair Masque Protect your delicate waves and curls from the damage of constant curling, twisting, braiding and straightening with SheaMoisture deep conditioner for dry, natural hair. Enriched with Raw Shea Butter, Castor Seed Oil, Olive Oil and other natural botanicals, this all-over hair conditioner infuses moisture where it's needed most, alleviating that straw-like dryness that can lead to hair loss. Our intensive treatment masque deeply moisturizes and conditions dry, damaged hair, when used as an after-shampoo treatment or deep conditioning treatment. Perfect for transitioning chemically treated hair to natural hair. It also gives those natural curls a healthy shine you can see and feel. Formulated with certified organic Product Details SheaMoisture is dedicated to maintaining the accuracy of the ingredient lists on this website. However, because raw ingredients listings are subject to change due to INCI, we cannot guarantee that these lists are complete, up-to-date and/or error-free. For an accurate listing of ingredients in each product, please refer to your product packaging. Usage Instructions Section clean, wet hair. Apply generously. Use a wide tooth comb to distribute evenly from root to ends. Leave in 5 minutes. Rinse thoroughly. For deep penetrating treatment, cover hair with a plastic cap and apply moderate heat for up to 30 minutes. Rinse thoroughly. When using a hair steamer do not cover hair, moist heat will add to masque¾_s hydration. Ingredients Water, Cetyl Alcohol, Butyrospermum Parkii (Shea) Butter*‰»«, Ricinus Communis (Castor) Seed Oil, Glycerin (Vegetable), Olea Europaea (Olive) Fruit Oil, Glyceryl Stearate Citrate, Cetearyl Alcohol, Panthenol, Aloe Barbadensis Leaf Juice, Argania Spinosa Kernel Oil, Persea Gratissima (Avocado) Oil, Hydrolyzed Vegetable Protein PG-Propyl Silanetriol, Glyceryl Caprylate, Daucus Carota Sativa (Carrot) Seed Oil, Macrocyst

Product Information

BrandShea Moisture
CategoryHair Mask
MPN / SKU764302280248
Item Group6102917120158
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI
Shea Moisture Raw Shea Butter deep treatment Masque 12oz — Bobby