(Kahisakan) Otaru Coffee House Canal BlendOut of stock
Kahisakan Co. Ltd.

(Kahisakan) Otaru Coffee House Canal Blend

$4.01
Out of StockUSUS
Title (1 variants)

Default Title

SKU: 4971930006850

$4.01

Out of stock

View Now

Description

(Kahisakan) Otaru Coffee House Canal (Unga) Blend is a box containing 5 individually wrapped single serving Premium Quality "Drip type" coffee filter packets. Otaru Coffee House Canal (Unga) Blend is a refined drip coffee experience inspired by the historic canals of Otaru, Hokkaido. This elegant gift box contains five individually wrapped, single-serve drip coffee filter packets, designed for effortless brewing and peak freshness. Carefully roasted in Otaru, this deep-roast blend showcases a bold, satisfying character with pronounced bitterness, a gentle touch of acidity, and a smooth, moderate body. The aroma is rich and inviting, leading to a deep, well-balanced flavor that lingers pleasantly on the palate. Crafted from premium coffee beans sourced from Ethiopia and Brazil, each cup reflects Kahisakan’s commitment to quality, craftsmanship, and authentic Japanese roasting tradition. Perfect for daily enjoyment or as a thoughtful gift for coffee lovers. Sweetness: ★★1/2☆☆ Acidity: ★★☆☆☆ Bitterness: ★★1/2☆☆ Body: ★★★☆☆ Aroma: ★★★☆☆ Instructions: (How to Brew). Follow these simple steps to "Drip Brew" (Kahisakan) Otaru Coffee House Canal Blend. 1. Tear open the package of Individual Single cup Packages. 2. Open the Individual package and remove the filter packet of Coffee. 3. Tear along the dotted line and remove the top of the Packet. 4. Place and Fold the Holder Handles over the edges of your cup. 5. Carefully pour hot water over the Coffee Grounds a little at a time. 6. Fill the Coffee Cup near to the rim of the cup. 7. When the Filter Packet is removed, the level in the cup will go down. You can also visit our " Brewing Drip Coffee Packets " page for complete instructions with pictures. Nutrition: (Serving Size 7g extracted in about 140ml Boiling water), Calorie : 3kcal, Protein 0.1g, Fat 0g, Carbohydrate 0.6g, Sodium 0g. Ingredients: Coffee Beans (Ground Beans: Brazil, Ethiopia, etc). Manufacturer: Kahisakan Co., Ltd., 5-30 Sakaimachi, Otaru, Hokkaido, Japan. S

Product Information

BrandKahisakan Co. Ltd.
CategoryGround Coffee
MPN / SKU4971930006850
Item Group7868578005040
CurrencyUSD
CountryUS

Ships to (235 countries)

ACACADADAEAEAFAFAGAGAIAIALALAMAMAOAOARARATATAUAUAWAWAXAXAZAZBABABBBBBDBDBEBEBFBFBGBGBHBHBIBIBJBJBLBLBMBMBNBNBOBOBQBQBRBRBSBSBTBTBWBWBYBYBZBZCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCWCWCXCXCYCYCZCZDEDEDJDJDKDKDMDMDODODZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGDGDGEGEGFGFGGGGGHGHGIGIGLGLGMGMGNGNGPGPGQGQGRGRGSGSGTGTGWGWGYGYHKHKHNHNHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIO
(Kahisakan) Otaru Coffee House Canal Blend — Bobby