White fishnet X floral tights
COAXcopenhagen.com

White fishnet X floral tights

€19.00
In StockDKDK
Size (1 variants)

One Size

SKU: 9727WHT

€19.00

In stock

View Now

Description

White Fishnet X Floral Tights Light, lacey, and made to provoke. These white floral fishnet tights blend delicate femininity with a cheeky twist. The soft Chantilly-inspired lace motif overlays an elastic fishnet base, giving your legs an ethereal feel that still knows how to flirt. Perfect for soft lingerie looks, bridal moods, or just adding a touch of innocence to something a little less pure. Romance with a wink Designed to hug your legs like a dream, the seamless construction offers comfort without sacrificing style. Whether you are dressing up or stripping down, this is COAX Copenhagen’s idea of white done right. Pair with heels, lace, or lingerie - these tights were made to tempt. DETAILS & FEATURES Elastic white fishnet base Chantilly-style floral lace pattern Seamless and soft to the touch 93% nylon / 7% spandex Ideal for romantic or risqué styling

Product Information

BrandCOAXcopenhagen.com
Categorycolor:White
MPN / SKU9727WHT
Item Group9274759840070
CurrencyEUR
CountryDK

Ships to (235 countries)

ADADAEAEAFAFAGAGAIAIALALAMAMAOAOARARATATAUAUAWAWAXAXAZAZBABABBBBBDBDBEBEBFBFBGBGBHBHBIBIBJBJBLBLBMBMBNBNBOBOBQBQBRBRBSBSBTBTBWBWBYBYBZBZCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCWCWCXCXCYCYCZCZDEDEDJDJDKDKDMDMDODODZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGDGDGEGEGFGFGGGGGHGHGIGIGLGLGMGMGNGNGPGPGQGQGRGRGSGSGTGTGWGWGYGYHKHKHNHNHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQ
White fishnet X floral tights — Bobby