Nittoh Melting Mango BlissOut of stock
Mitsui Norin Co. Ltd.

Nittoh Melting Mango Bliss

$4.19
Out of StockUSUS
Title (1 variants)

Default Title

SKU: 4902831512300

$4.19

In stock

View Now

Description

Nittoh Melting Mango Bliss is a divine symphony of flavors elegantly captured in meticulously crafted, individually packaged "stick" type instant Mango packets. Nittoh Melting Mango Bliss is a luxuriously smooth instant mango fruit drink that captures the irresistible sweetness and juicy aroma of perfectly ripened mangoes. Each box includes 8 individually wrapped stick packets, making it easy to enjoy a refreshing tropical escape anytime, anywhere. Crafted using Alphonso mango puree powder to provide an authentic, sweet, and juicy aroma with a "melting" mouthfeel, this delightful blend dissolves effortlessly into hot or cold water. The result is a vibrant, silky-smooth drink with a luscious fruit flavor that feels indulgent yet refreshing. Simply pour, stir, and savor a moment of pure mango bliss—bright, aromatic, and beautifully satisfying in every sip. Instructions: ( How to Brew). J ust by putting one stick in a cup and pouring hot water, you can easily enjoy an authentic Nittoh Melting Mango Bliss Fruit drink anytime. Hot : Pour one stick in a cup of hot water (150ml), stir well and enjoy. Iced : Pour 1 stick into Cold Water (150ml). Add several pieces of ice and stir well until it becomes cold. Ingredients: Sugar preparation (sugar, dextrin) (manufactured in Thailand), mango puree powder (dextrin, mango puree), salt Additives: Acidulant, flavoring, thickener (xanthan gum), sweetener (acesulfame potassium, stevia), marigold color, caramel color, thickener (guar gum). Nutrition: Per Serving (10g): Energy 39kcal, Protein 0.0g, Fat 0.0g, Carbohydrate 9.8g, Salt equivalent 0.04g. Manufacturer: Mitsui Norin Co., Ltd. 1-2-9 Nishi-Shimbashi, Minato-ku, Tokyo, Japan. Factory: 223-1 Miyahara, Fujieda, Shizuoka, Japan. Size: Height: 20 cm. Width: 10 cm. Depth: 5 cm. Weight: 80 grams (8 Sticks x 10 grams). Disclaimer: Japanese Green Tea Shops strives to display the latest product information on our site, but the product specifications ( C apacity, P ackage Design, Ingredie

Product Information

BrandMitsui Norin Co. Ltd.
CategoryInstant Tea
MPN / SKU4902831512300
Item Group7909859393584
CurrencyUSD
CountryUS

Ships to (235 countries)

ACACADADAEAEAFAFAGAGAIAIALALAMAMAOAOARARATATAUAUAWAWAXAXAZAZBABABBBBBDBDBEBEBFBFBGBGBHBHBIBIBJBJBLBLBMBMBNBNBOBOBQBQBRBRBSBSBTBTBWBWBYBYBZBZCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCWCWCXCXCYCYCZCZDEDEDJDJDKDKDMDMDODODZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGDGDGEGEGFGFGGGGGHGHGIGIGLGLGMGMGNGNGPGPGQGQGRGRGSGSGTGTGWGWGYGYHKHKHNHNHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIO
Nittoh Melting Mango Bliss — Bobby