Perfect White Lightening Beauty Lotion  WITHOUT HYDROQUINONE
Dream Cosmetics

Perfect White Lightening Beauty Lotion WITHOUT HYDROQUINONE

BHD 4.80
In StockBHBH
Size (1 variants)

250ml

SKU: 6181100530384

BHD 4.80

In stock

View Now

Description

Perfect White Hydroquinone Free Lightening Beauty Lotion is specially conceived for a fast and effective action. This item is perfect because your skin is clear, fresh and smooth like a babyÕs skin ! Without Hydroquinone. Perfect White Lightening Beauty Lotion 250ml WITHOUT HYDROQUINONE Perfect White Hydroquinone Free Lightening Beauty Lotion is specially conceived for a fast and effective action. This item is perfect because your skin is clear, fresh and smooth like a babyÕs skin ! Without Hydroquinone. Whitening cream.Healthy, naturally glowing skin in 2 weeks. Use twice a day for best results. Apply generously and massage till it get absorbed. *Healing by moisturization of normal dry skin. Action in the epidermal region and within cosmetic domain. Fast Absorbing lotion provides healing moisture for healthy looking skin. Non-Greasy Lotion. Helps repair skin damage and leaves skin smooth and moisturized Absorbs deeply to moisturize and help heal dry skin from within Engineered with Micro Droplets of Vaseline Jelly to lock in moisture Suitable for all skin types.

Product Information

BrandDream Cosmetics
CategoryLotion
MPN / SKU6181100530384
Item Group6548056211614
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI