Curlessence Moisturizing Cowash
Curlessence

Curlessence Moisturizing Cowash

BHD 6.00
In StockBHBH
Size (1 variants)

12oz

SKU: 796708330845

BHD 6.00

In stock

View Now

Description

With Jamaican Black Castor Oil & Coconut Oil Iconic Moisture! Size: 355 ml (12 fl. oz.) FEATURES Features Jamaican Black Castor Oil & Coconut Oil to lock in amazing moisture Ð leaving your hair soft, manageable and healthy. This sulfate-free cleansing conditioner helps moisturize, detangle and define natural hair. Ideal for gently cleansing without stripping the natural moisture from coils and curls. BENEFITS Gentlest cleansing for hair & scalp. Significantly helps comb hair. Leaves hair feeling extremely soft and smooth. DIRECTIONS Apply liberally to wet hair and distribute evenly to work up a nice lather. Massage into scalp using fingertips to loosen dandruff, dirt and product residue. Gently detangle with fingers or a wide-toothed comb. Rinse thoroughly. Apply CURLESSENCEª Moisturizing Leave In Conditioner and proceed to style as usual.

Product Information

BrandCurlessence
CategoryCo Wash
MPN / SKU796708330845
Item Group6070968680606
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI
Curlessence Moisturizing Cowash — Bobby