Eco Styler Gel Color Treated Hair Gel (Yellow)
Ecoco

Eco Styler Gel Color Treated Hair Gel (Yellow)

BHD 4.80
In StockBHBH
Size (1 variants)

16oz

SKU: 748378001167

BHD 4.80

In stock

View Now

Description

Eco Styler Colored Hair Styling Gel is specially formulated for color or highlighted hair. It is weightless and provides gravity-defying hold for all styles. Eco Styler Colored Hair Styling Gel is strong holding, water based and will provide moisture to help maintain healthy hair. Usage & Ingredients How to Use: Apply to dry or wet hair. Work desired amount through hair and style. Can also be used with a curling iron or blow dry for a casual look. Ingredients: Water, Carbomer Carmel, Hydrolyzed Wheat Protein, PVP, Glycerin, Tea Tree (Melaleuca Alternifolia) Oil, Chamomile (Anthemis Nobilis), Asiathica, Trietahnolamine, Sodium Hydrxymethyl), Glycinate, Polysorbate 20, Tetrasodium Edta, Fragrance.

Product Information

BrandEcoco
CategoryStyling Gel
MPN / SKU748378001167
Item Group6128784015518
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI
Eco Styler Gel Color Treated Hair Gel (Yellow) — Bobby